Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTDTRHMYGGPGFGHYQGFGIGHPGYGMQSTGYPGYGMYGGHPGYGMQGYPDHGIHGGVGGYPGYGGYGGYPSGGYGGSPGTGSYPSMHHENDGHHHYYHHHHDGKDNLHHHHHHVGKDNHHHHHDGHYGHHHHHMGHWGKDGYK 1W5K Chain:A ((2-34)) --------------------------------------------------------------------------------------RMRQIEDRLEEILSKLHHICNELARIRRLLGER--------------------------

General information: TITO was launched using: RESULT: Template: 1W5K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 438 219.00 13.27 target 2D structure prediction score : 0.21 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 219.00 2D Compatibility (Sec. Struct. Predict.) : 0.21 1D Compatibility (Hydrophobicity) : 0.56 QMean score : -0.363

(partial model without unconserved sides chains): PDB file : Tito_1W5K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W5K-query.scw PDB file : Tito_Scwrl_1W5K.pdb: