Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSVCDPGRGQPYVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSME-------------YYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQPIWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQFRVFESFYEHVNQKLPEPPPLASNLFAQLAE--------------------
1TRK Chain:A ((3-337))QFTDIDKLAVSTIRILAVDTVSKANSGHPGAPLGMAPAAHVLWSQMRMN-PTNPDWINRDRFVLSNGHAVALLYSMLHLTGYDLSIEDLKQF-RQLGSRTPGHPEFELPGV-EVTTGPLGQGISNAVGMAMAQANLAATYNKPGFTLSDNY--TYVFLGDGCLQEGISSEASSLAGHLKLGNLIAIYDDNKITIDGATSISFDEDVAKRYEAYGWEVLYVENGN--EDLAGIAKAIAQAKLSKDKPTLIKMTTTI---GYGSLHAGSHSVHGAPLKADDVKQLKSKFGFNPDKSFVVPQEVYDHYQKTILKPGVEANNKWNKLFSEYQKKFPELGAELARRLSGQ


General information:
TITO was launched using:
RESULT:

Template: 1TRK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -90509 for 2061 contacts (-43.9/contact) +
2D Compatibility (PS) -28483 + (NN) -9181 + (LL) 1044
1D Compatibility (HY) 1600 + (ID) 2050
Total energy: -127579.0 ( -61.90 by residue)
QMean score : 0.177

(partial model without unconserved sides chains):
PDB file : Tito_1TRK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1TRK-query.scw
PDB file : Tito_Scwrl_1TRK.pdb: