Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------QAPPPVQCD-------PGKLSACAVPIFFGTAPS-------KSCCSNLRA---QEKDGCFCQYARDPMYASYINSTNARNTIAACGI---AFPSC-------------------------
1SZH Chain:A ((4-150))STLTKELIKDAAEKCCTRNRQECCIEIMKFGTPIRCGYDRDPKLPGYVYKCLQNVLFAKEPKKKINLDDSVCCSVFGNDQEDSGRRCENRCKNL-MTSPSIDAATRLDSIKSCSLLDNVLYKCFEKCRSLRKDGIKIEVLQFEEYCEA


General information:
TITO was launched using:
RESULT:

Template: 1SZH.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -17767 for 420 contacts (-42.3/contact) +
2D Compatibility (PS) -7617 + (NN) -1933 + (LL) -140
1D Compatibility (HY) -5600 + (ID) 800
Total energy: -33857.0 ( -80.61 by residue)
QMean score : 0.199

(partial model without unconserved sides chains):
PDB file : Tito_1SZH.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1SZH-query.scw
PDB file : Tito_Scwrl_1SZH.pdb: