Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFSNIGIPGLILIFVIALIIFGPSKLPEIGRAAGRTLLEFKSATKSLVSGDEKEEKSAELTAVKQDKNAG 2MI2 Chain:A ((1-61)) -MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQD--------

General information: TITO was launched using: RESULT: Template: 2MI2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 55 -4223 -76.77 -69.22 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -76.77 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.529

(partial model without unconserved sides chains): PDB file : Tito_2MI2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MI2-query.scw PDB file : Tito_Scwrl_2MI2.pdb: