Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSAV---TWVIKHWSEFSGWINALMEKL 2PQC Chain:A ((400-435)) -------------------------------------------------RIAMSFLVMGLVSENPVTVDDATMIATSFPEFMDLM

General information: TITO was launched using: RESULT: Template: 2PQC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 65 -23611 -363.24 -715.47 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -363.24 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.309

(partial model without unconserved sides chains): PDB file : Tito_2PQC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PQC-query.scw PDB file : Tito_Scwrl_2PQC.pdb: