Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKFSVILGMIRCSLTHITTKNTVNALKRMIY-PKQKPSFFH--EFKVLYKLLKKFCIKGIMIKNIRSCMGYFL 4J8C Chain:A ((5-40)) --------------------PRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESM------------------

General information: TITO was launched using: RESULT: Template: 4J8C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 21 -8230 -391.90 -249.39 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -391.90 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.503

(partial model without unconserved sides chains): PDB file : Tito_4J8C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4J8C-query.scw PDB file : Tito_Scwrl_4J8C.pdb: