Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSD-RDLDVLVKEMCEKL-LANTVIEDYRYEVEEVVAQ 2ZW2 Chain:A ((5-77)) LYRVELIITNKEGVRDPEGETIQRYVVSRFSDKIIETRAGKYLVFRVNSSSQQEATELVKKLADEMRLYNPIV-------------

General information: TITO was launched using: RESULT: Template: 2ZW2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 178 -25252 -141.86 -355.65 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -141.86 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.636

(partial model without unconserved sides chains): PDB file : Tito_2ZW2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZW2-query.scw PDB file : Tito_Scwrl_2ZW2.pdb: