Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETVESEKCCDSLRKKNLDY 4GYJ Chain:A ((239-290)) ---------------------YGLPLVSHGQERLREVELYPFQKAI--DAGADMVMTAHVQFPAFDDTTYKSKLD-

General information: TITO was launched using: RESULT: Template: 4GYJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 72 -1907 -26.48 -36.66 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -26.48 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.341

(partial model without unconserved sides chains): PDB file : Tito_4GYJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4GYJ-query.scw PDB file : Tito_Scwrl_4GYJ.pdb: