Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIIVYISLAVLAVSIIFLGVTVIQNKKKIDPALKELSSVTQAMQKQIEGLKTETELLTQKQKKIQQDVQIKKYTLQQTAAEVKEVPQAVKEVWQAGHFNSR 4JF3 Chain:A ((44-101)) -----------------LAEVVLQNRRGLDLLTAEQGGICLALQEKCSFYANKSGIVRDKIKNLQDDLERRRRQL--------------------------

General information: TITO was launched using: RESULT: Template: 4JF3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 60 -4547 -75.78 -78.39 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -75.78 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.559

(partial model without unconserved sides chains): PDB file : Tito_4JF3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4JF3-query.scw PDB file : Tito_Scwrl_4JF3.pdb: