Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAIIINIDVMLAKRKMSVTELSERVGITMANLSILKNGKAKAIRLSTLEAICKALECQPGDILEYRSDEDTGFVKKKYEGSTEK 1RPE Chain:L ((15-63)) ---------------LNQAELAQKVGTTQQSIEQLENGKTKRPRF--LPELASALGVSVDWLLNGT------------------

General information: TITO was launched using: RESULT: Template: 1RPE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 144 -24361 -169.17 -497.15 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain L : 0.66 3D Compatibility (PKB) : -169.17 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.679

(partial model without unconserved sides chains): PDB file : Tito_1RPE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RPE-query.scw PDB file : Tito_Scwrl_1RPE.pdb: