Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIHKNWLEKETIKKVKCVQTNAKKYIVNRVLTPGKEYEVKNETEEFLFVVDNTNKVGGYYKEYFEEM 1PT6 Chain:A ((7-22)) ------------------------------------------QLDIVIVLDGSNSIYP---------

General information: TITO was launched using: RESULT: Template: 1PT6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -315 -157.25 -19.66 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -157.25 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.475

(partial model without unconserved sides chains): PDB file : Tito_1PT6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PT6-query.scw PDB file : Tito_Scwrl_1PT6.pdb: