Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRDRGTIKWTSMMLPEHLTQLKQDLIDVSKIEKPSLDDQQIEEMDILVSEALEFNKELQFKLFHNGFVENVTGRVHYINFE--QQKLHVKDQNDNTVYINMNNIIGVTYND 1SG5 Chain:A ((15-76)) ---------------------------------------------YDNLELACQHHLMLTLEL-KDGE--KLQAKASDLVSRKNVEYLVVEAA-GETRELRLDKITSFSHP-

General information: TITO was launched using: RESULT: Template: 1SG5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 199 -3614 -18.16 -60.23 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -18.16 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.510

(partial model without unconserved sides chains): PDB file : Tito_1SG5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SG5-query.scw PDB file : Tito_Scwrl_1SG5.pdb: