Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF 1MFQ Chain:C ((90-114)) ----------------RIQRVARGSGVSTRDVQELLTQYTK----------------

General information: TITO was launched using: RESULT: Template: 1MFQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 36 -4462 -123.94 -178.48 target 2D structure prediction score : 0.96 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -123.94 2D Compatibility (Sec. Struct. Predict.) : 0.96 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.985

(partial model without unconserved sides chains): PDB file : Tito_1MFQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1MFQ-query.scw PDB file : Tito_Scwrl_1MFQ.pdb: