Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVANDYEKRDNNSYYVDHGSEGTNITRDNDGFFEETAAEIAEPYRAADRSNDQDNDRSGGNVNEGRGIGYIALALSIISLFVLPVLLGAAGIIVGYIARRRGAQGLGAWAMGIGVVSLVLGIFIIPFF 2C9X Chain:A ((211-240)) -------------TYWVKHLNEITVIDKEFDGFWMKTAFRIPD--------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2C9X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 21 -85 -4.02 -2.82 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -4.02 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.449

(partial model without unconserved sides chains): PDB file : Tito_2C9X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2C9X-query.scw PDB file : Tito_Scwrl_2C9X.pdb: