Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRYMKLFFLVTDIGFILYWLSAGFSLIPESWAFKHHDHPFMIAWNWSFFPLDILISVTGLYSLYLQRVNRADWKLMALISLVLTCCSGLQALSFWTFSSDFDLVWWLFNGYLLIYPLFFIHLLLKEGRRTKQS 1N0X Chain:P ((3-15)) ----------------------------RSYMFSDLENRCIA-------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1N0X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 12 -3070 -255.83 -236.15 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain P : 0.36 3D Compatibility (PKB) : -255.83 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.36 QMean score : 0.622

(partial model without unconserved sides chains): PDB file : Tito_1N0X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1N0X-query.scw PDB file : Tito_Scwrl_1N0X.pdb: