Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMPSRNILVINCGSSSIKFALVNEAHSLFPLHGLAERLGSRDAVLRWKRGGDSDSLMIPNADHRAALAQL-LPMVQNAAGGKLHGIGHRVVHGGELFTHATRIDDRVVEAIRATAPLAPLHNPANLQGIEAAMTLFPKLPHVAVFDTAFHQSLPEHAYRYALPEALYREHGVRRYGFHGTSHRYVSHRAAEMAGLAVGDSSWLSAHLGNGSSTCAIVNGQSLDTSMGLTPLEGLVMGTRSGDVDPNLHSHLARTLGWSLERIDSMLNNESGLLGLSDLSNDMRTLEQEREQGHPGAALAIEVFCYRLAKSLAAMSCALPQLDGVIFTGGIGENSPLVRAKTAAHLRLFDLRLDQEANARCVRGVAGPIQAAGHPRVL--VIPTNEERQIALDTLALLD
2E1Z Chain:A ((20-405))-----VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFLSIN--GDK-PINLAHSNYEDALKAIAFELEKRDLTDSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVRQVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGLSSDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLHRLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP-NSHGERIISANPSQVICAVIPTNEEKMIALDAIHLGN


General information:
TITO was launched using:
RESULT:

Template: 2E1Z.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -205690 for 3248 contacts (-63.3/contact) +
2D Compatibility (PS) -41691 + (NN) -16693 + (LL) 104
1D Compatibility (HY) -36400 + (ID) 9400
Total energy: -309770.0 ( -95.37 by residue)
QMean score : 0.502

(partial model without unconserved sides chains):
PDB file : Tito_2E1Z.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2E1Z-query.scw
PDB file : Tito_Scwrl_2E1Z.pdb: