Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------MGTVNIQVEIDPEAYVTGLEHAKETKLMPEELLEGENNG---------------------------------
4EYT Chain:A ((10-106))KQNCLIKIINIPQGTLKAEVVLAVRHLGY-EFYCDYIDGQAMIRFQNSDEQRLAIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKN


General information:
TITO was launched using:
RESULT:

Template: 4EYT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 1698 for 170 contacts (10.0/contact) +
2D Compatibility (PS) -4409 + (NN) -2244 + (LL) 192
1D Compatibility (HY) -2800 + (ID) 350
Total energy: -7913.0 ( -46.55 by residue)
QMean score : 0.340

(partial model without unconserved sides chains):
PDB file : Tito_4EYT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4EYT-query.scw
PDB file : Tito_Scwrl_4EYT.pdb: