Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------------MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQAN----------------------- 4G7V Chain:S ((23-158)) GVGRVQFRVRAVIDHLGMRVFGVFLIFLDIILMIIDLSLPGKSESSQSFYDGMALALSCYFMLDLGLRIFAYGPKNFFTNPWEVADGLIIVVTFVVTIFYTVL--DEYVQETGADGLGELVVLARLLRVVRLARIFYS

General information: TITO was launched using: RESULT: Template: 4G7V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain S - contact count / total energy / energy per contact / energy per residue : 99 -21119 -213.32 -357.95 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain S : 0.52 3D Compatibility (PKB) : -213.32 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.090

(partial model without unconserved sides chains): PDB file : Tito_4G7V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4G7V-query.scw PDB file : Tito_Scwrl_4G7V.pdb: