Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKFPVYIHSISGNSVFNN--GFAVSISPFSVSKTTEGSGGSNTGLVFESNALSQTSSANQAQNVTYAIQELLSKLLA 2Z1C Chain:A ((2-72)) CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGD-----WVIVHTGFAIEKLDEKKAMEILEAWAEVEKAM--

General information: TITO was launched using: RESULT: Template: 2Z1C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 235 -25440 -108.26 -368.70 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -108.26 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.578

(partial model without unconserved sides chains): PDB file : Tito_2Z1C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Z1C-query.scw PDB file : Tito_Scwrl_2Z1C.pdb: