Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------MLGRTKLGNRNAQANNNAKKKNGFQTHFDSYAGREAEKLIASNKRHND 3F5H Chain:A ((12-65)) SIDDLDAEALIRMALGPRNTMTSSNEQLVDALRASLKENEELRKESRRRADRRQ--

General information: TITO was launched using: RESULT: Template: 3F5H.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 29 3105 107.07 67.50 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 107.07 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.476

(partial model without unconserved sides chains): PDB file : Tito_3F5H.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3F5H-query.scw PDB file : Tito_Scwrl_3F5H.pdb: