Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------------------MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTYYECAGTCLGTCTHNQTTYSVCDPGRGQPYVCYDPKSSPGTWFEIHVGSKEGDLLNQTKVFP---------SGKDVVSLYFDVCQIVSMGSLFPVI--FSSMEYYSSCHKNRYAHP-------------ACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQPIWTTGLKAPLGARVSGE-EIGPGAYVYLYIIKKTRTRSTQQ-FRVFESFYEHVNQKLPEPPPLASNLFAQLAE------------------
2WM9 Chain:A ((5-427))STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEADVHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFF---EDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL


General information:
TITO was launched using:
RESULT:

Template: 2WM9.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -51365 for 1808 contacts (-28.4/contact) +
2D Compatibility (PS) -28680 + (NN) -1589 + (LL) 220
1D Compatibility (HY) -3200 + (ID) 1950
Total energy: -86564.0 ( -47.88 by residue)
QMean score : 0.050

(partial model without unconserved sides chains):
PDB file : Tito_2WM9.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2WM9-query.scw
PDB file : Tito_Scwrl_2WM9.pdb: