Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------MMFYNILGVLILVMLSTDALDCDIITHL--RTSLINFLPIQSLLSALKNPYC-
4TYZ Chain:A ((1-109))NIEGVFRKSFPDLAGETLLDSFNCAWVEGSALKQGYLFITPHWLCFQSTLAAAHFSIEYDEIKDIIKSKSVKMFENAIEVKTHLNDTIFLTNFLQRDQAYSALMSQWLK


General information:
TITO was launched using:
RESULT:

Template: 4TYZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -47669 for 273 contacts (-174.6/contact) +
2D Compatibility (PS) -5014 + (NN) 3580 + (LL) 0
1D Compatibility (HY) -1600 + (ID) 550
Total energy: -51253.0 ( -187.74 by residue)
QMean score : 0.245

(partial model without unconserved sides chains):
PDB file : Tito_4TYZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4TYZ-query.scw
PDB file : Tito_Scwrl_4TYZ.pdb: