Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------VKLPPEADYLNDETLEVYENDKKKYDQTNQLITNNSVTILLGDFCYYESAWSSRWRDNRFWIGSKVS----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4X2Z Chain:A ((9-309))QKTIYLTEDGVKYRSIVLKPGDSLGQFGQVYAKNKIVFTADDVEDKEILYVPTT----DKSILEYYGLDAQKYVIYLQTLAQKWNVQYRDNFLILE------WRDGNCWISSAIVLLQAAKIRFKGFLTEAWAKLLGGDPTDFVAWCYASCTAKVGDFSDANWLLANLAEHFDADYTNAFLKKRVSCNCGIKSYELRGLEACIQPVRATNLLHFKTQYSNCPTCGANNTDEVIEASLPYLLLFATDGPATVDCDEDAVGTVVFVGSTNSGHCYTQAAGQAFDNLAKDRKFGKKSPYITAMYTRFAFKNETS


General information:
TITO was launched using:
RESULT:

Template: 4X2Z.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 5167 for 272 contacts (19.0/contact) +
2D Compatibility (PS) -5894 + (NN) 1730 + (LL) 652
1D Compatibility (HY) -5200 + (ID) 800
Total energy: -4345.0 ( -15.97 by residue)
QMean score : 0.345

(partial model without unconserved sides chains):
PDB file : Tito_4X2Z.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4X2Z-query.scw
PDB file : Tito_Scwrl_4X2Z.pdb: