Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMYIHLGDDFVVSTRDIVGI-----FDFKANMS--PIVEEFLK----------KQKHKVVPSVNGTPKSIVVTVQNIYYSPLSSSTLKKRAQFMFEIDS
1PRT Chain:F ((2-99))LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAISAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE


General information:
TITO was launched using:
RESULT:

Template: 1PRT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -4264 for 521 contacts (-8.2/contact) +
2D Compatibility (PS) -8223 + (NN) 2110 + (LL) 0
1D Compatibility (HY) -2800 + (ID) 800
Total energy: -13977.0 ( -26.83 by residue)
QMean score : -0.092

(partial model without unconserved sides chains):
PDB file : Tito_1PRT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1PRT-query.scw
PDB file : Tito_Scwrl_1PRT.pdb: