Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKILGVTGFILICL-----LAISVLMDMLQGFSLTKAVYNNMSSFKMTTFAEWVV-----LLFFVLVLVREMYVIYKSKKKNP- 1HDM Chain:A ((13-93)) -LQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFS--QNTRVPRLPEFADWAQEQGDAILFDKEFCEWMIQQIPKLDGKIPV

General information: TITO was launched using: RESULT: Template: 1HDM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 176 -34469 -195.85 -492.41 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -195.85 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.319

(partial model without unconserved sides chains): PDB file : Tito_1HDM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HDM-query.scw PDB file : Tito_Scwrl_1HDM.pdb: