Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIKFSVILGMIRCSLTHITTK-NTVNALKRMIYPKQKPSFFHEFKVLYKLLKKFCIK--------GIMIKNIRSCMGYFL--- 3EVY Chain:A ((662-744)) MKPYEKLVERFNEMAAEFLSYFPTVKSVGNLESELDKRRFVILFRAMLRLRNEVKGYNEFDAEDLTIEEQRFADYQSKYLDMS

General information: TITO was launched using: RESULT: Template: 3EVY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 164 -38427 -234.31 -541.23 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -234.31 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.592

(partial model without unconserved sides chains): PDB file : Tito_3EVY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EVY-query.scw PDB file : Tito_Scwrl_3EVY.pdb: