Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKLTKEELIFLVKELMNPTL-DDEKVSEYLDLLEKNVPYPAPSDLIFWSNE--DYTAEQVVKIALNYKDE 1FR2 Chain:A ((8-76)) -SDYTEAEFLQLVTTICNADTSSEEELVKLVTHFAEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRA-

General information: TITO was launched using: RESULT: Template: 1FR2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 197 -37229 -188.98 -564.08 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -188.98 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.771

(partial model without unconserved sides chains): PDB file : Tito_1FR2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FR2-query.scw PDB file : Tito_Scwrl_1FR2.pdb: