Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -MR-LSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIGSDMIILDVPEEMPPRQE 1PM3 Chain:A ((0-77)) HMRIVEEMVGKEVLD-SSAKVIGKV--KDVEVDIESQAIESLVLG--------KGGGETIVPYEMVKKIG-DKILLKGPEE------

General information: TITO was launched using: RESULT: Template: 1PM3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 239 -31738 -132.79 -473.69 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -132.79 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.707

(partial model without unconserved sides chains): PDB file : Tito_1PM3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PM3-query.scw PDB file : Tito_Scwrl_1PM3.pdb: