Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEIKANSTVMIHVLADETLSSIKREYVEVDRKTEIGEKIIIVDKNDPDDEYENGAI 3OUG Chain:A ((78-94)) -----------------------------AARRCEIGDQLFIISYT-----------

General information: TITO was launched using: RESULT: Template: 3OUG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 4 -901 -225.25 -53.00 target 2D structure prediction score : 0.94 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -225.25 2D Compatibility (Sec. Struct. Predict.) : 0.94 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.798

(partial model without unconserved sides chains): PDB file : Tito_3OUG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3OUG-query.scw PDB file : Tito_Scwrl_3OUG.pdb: