Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMLEQLIQLKQDLIDGSKVEKPSLDDKQIDEMDILVSEALEFNKELKFKLFNKGFVENVTGRVHYINFEQQKLHVKDQNDNTVYINMNNIIRVIYND 3HFN Chain:A ((13-68)) ---------------------------------RQLQNLIKQAAPVEIKLVTG---DAITGRVLWQD--PTCVCIAD---RQTTIWKQAIAYLQ---

General information: TITO was launched using: RESULT: Template: 3HFN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 199 -42537 -213.75 -802.58 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -213.75 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.742

(partial model without unconserved sides chains): PDB file : Tito_3HFN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3HFN-query.scw PDB file : Tito_Scwrl_3HFN.pdb: