Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKWNPLIPFLLIAVLGIGLTFFLSVKGLDDSREIASGGESKSAEKKDANASPEEIYKANCIACHGENYEGVSGPSLKGVGDKKDVAEIKTKIEKGGNGMPSGLVPADKLDDMAEWVSKIK 1K3G Chain:A ((4-71)) ----------------------------------------------------EAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

General information: TITO was launched using: RESULT: Template: 1K3G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 258 -29363 -113.81 -431.81 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -113.81 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.526

(partial model without unconserved sides chains): PDB file : Tito_1K3G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1K3G-query.scw PDB file : Tito_Scwrl_1K3G.pdb: