Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDETKSELLRKYEQKFKALADQKRLEIMYELCQRGKTCVCDLTEIFEVTQSKLSYHLKILLDANLITKETKGTWSYYDLNDEEVNGLLSEELCCIFRKKGEGDCC 1U2W Chain:C ((34-108)) -------------QILKAIADENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALYSLGDEHIRQIM-----------------

General information: TITO was launched using: RESULT: Template: 1U2W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 298 -53163 -178.40 -708.83 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain C : 0.78 3D Compatibility (PKB) : -178.40 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.656

(partial model without unconserved sides chains): PDB file : Tito_1U2W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1U2W-query.scw PDB file : Tito_Scwrl_1U2W.pdb: