Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPKMKTHRGSAKRFKKTGSGKLKRSHAYTSHLFANKSQKQKRKLRKSA--VVSAGDFKRIKQMLANIK 3V9B Chain:A ((170-206)) -------------------------------IFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLK

General information: TITO was launched using: RESULT: Template: 3V9B.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 24 1891 78.77 54.01 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : 78.77 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.777

(partial model without unconserved sides chains): PDB file : Tito_3V9B.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V9B-query.scw PDB file : Tito_Scwrl_3V9B.pdb: