Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN 2NWA Chain:A ((1-80)) MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVN

General information: TITO was launched using: RESULT: Template: 2NWA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 307 -16838 -54.85 -213.14 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.99 3D Compatibility (PKB) : -54.85 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.99 QMean score : 0.553

(partial model without unconserved sides chains): PDB file : Tito_2NWA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2NWA-query.scw PDB file : Tito_Scwrl_2NWA.pdb: