Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEIKLKYDTVIKTLDSVKDALADVSIGAAGSNGKNSLDYTKKYHEREENIKTMLGDYKKAVQKNIEDTKDNVDSLKEQDEAIAVK 4WII Chain:A ((214-252)) ---------------------------------------FEYEYSQRWKSLDEMEKQQREQVEKNMKDAKDKLESEME--------

General information: TITO was launched using: RESULT: Template: 4WII.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -592 -296.00 -15.18 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -296.00 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.703

(partial model without unconserved sides chains): PDB file : Tito_4WII.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WII-query.scw PDB file : Tito_Scwrl_4WII.pdb: