Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSPAQRRILLYI------LSFIFVIGAVVYFVK--------SDYLFTLIFIAIAILFGMRARKADSR 2GUZ Chain:B ((1-65)) MTLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREK--

General information: TITO was launched using: RESULT: Template: 2GUZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 114 -11907 -104.44 -233.46 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -104.44 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.592

(partial model without unconserved sides chains): PDB file : Tito_2GUZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GUZ-query.scw PDB file : Tito_Scwrl_2GUZ.pdb: