Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK--------------------------------
3EUJ Chain:B ((63-152))DVQTQIVTAIQAELAHFRNTAQPINLGAVLQEQLARYPQSRHFDVARIIVDQAVKLGMASQDHQAVYPVWQPIDDFSAAVQAHLIDQYDK


General information:
TITO was launched using:
RESULT:

Template: 3EUJ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 6169 for 157 contacts (39.3/contact) +
2D Compatibility (PS) -3629 + (NN) -2969 + (LL) 0
1D Compatibility (HY) -1600 + (ID) 450
Total energy: -2479.0 ( -15.79 by residue)
QMean score : 0.939

(partial model without unconserved sides chains):
PDB file : Tito_3EUJ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3EUJ-query.scw
PDB file : Tito_Scwrl_3EUJ.pdb: