@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A3TLW1_9MICO: (2019-01-25 )
MPTLFEGETPVDLDTVGSFVAQQCPQWGHLPLRAMTTSGTEHTTYRLGDELLVRVPRDASSEAGLRKEIDWLPRLRDGVDLEMPVIEHVGAPSLDYPHTWTINRWVSGEDASARVLAGDVPSSWADVLAELVASLRAVDLREFAPHELPQGQRGGHVRCRVEALHGQTDPMSGPLDPTPVMGLMEAALDAGAPAPEPVLLHGDLIPGNLVVRNGRLSGLLDFGTLTTGYAAWDLTPAWWVLDRSGRERFRELLEVDDVSWAWGRAFAASQGLLADWVYAPRGHALAPLGARAVAEALAD

Atome Classification :

(20 SA) -----.........10.-.......20......------..30......-..40-......----.------------.50........60---.-...-.....70....-..-.--.80........90...--------.....100.......110..---.---.----------.-------.---.120.......130.-....-..140---..-...-..----.-.150.-...------.....160---.-......170---.--...-------.----....180.......190...--..-..----..200.......210.----.---.---....220.....-..230..--.....240--.--------------------.-----...---.--------------------...250..------.----.-----------...260.......270--..-.....280....-....290.......---------------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -----MPTLFEGETPVD-LDTVGSFVAQQCPQW------GHLPLRAMTT-SGTE-HTTYRL----G------------DELLVRVPRDAS----S-EAG-LRKEIDWLPRL-RD-G--VDLEMPVIEHVGAPSL--------DYPHTWTINRWVSGEDASAR---V---L----------A-------G---DVPSSWADVLAELVA-SLRA-VDL-----RE-FAP-HE----L-PQ--G-QRG------GHVRCRVE---A-LHGQTDP-----M--SGP-------L----DPTPVMGLMEAALDA--GAP--AP-EP----VLLHGDLIPGNLVVRN----G---R---LSGLLDFGTLTT-GYAAWDL--TPAWWV----L--------------------D-----RSG---R--------------------ERFRELLE------V----D-----------DVSWAWGRAFAASQGL--LA-DWVYAPR-GHAL-APLGARAVAEALAD---------------------------------
141 HHSearch 79.4318% -40 - C3 - - 3TDW ? A:[4-298] ----------------N-KLHYTTMIMTQFPDI------SIQSVESLG--EGFR-NYAILV----N------------GDWVFRFPKSQQ----G-ADE-LNKEIQLLPLL-VG-C--VKVNIPQYVYIGKR----------SDGNPFVGYRKVQGQILGED---GMAVL----------P-------D---DAKDRLALQLAEFMN-ELSA-FPV-----ET--AI-SA----G-VP--VTNLK------NKILLLSE---A-VEDQVFP-----L--LDE-------S----LRDYLTLRFQSYMTHP-VYT--RY-TP----RLIHGDLSPDHFLTNLNSRQT---P---LTGIIDFGDAAI-SDPDYDY--VYLLED----C--------------------G-----ELF------------------------TRQVMAYRGEV---D----L-----------DTHIRKVSLFVTFDQV--SY-LLEGLRARDQDW-ISEGLELLEEDKA----------------------------------
139 HHSearch 76.4513% -39 - C- - - 3N4U - ? A:[3-299] --------------TYT-FDQVEKAIEQLYPDF------TINTIEISG--EGND-CIAYEI----N------------RDFIFKFPKHSR----G-STN-LFNEVNILKRI-HN-K--LPLPIPEVVFTGMPSE--------TYQMSFAGFTKIKGVPLTPL---LLNNL----------P-------K---QSQNQAAKDLARFLS-ELHS-INI-----SG--FK-SN----L--V--L-DFR------EKINEDNK---K-IKKLLSR-----E--LKG-------P----QMKKVDDFYRDILENE-IYF--KY-YP----CLIHNDFSSDHILFDTEK--N---T---ICGIIDFGDAAI-SDPDNDF--ISLMEDDEE-Y--------------------G-----MEF---V--------------------SKILNHYKHK----D----I-----------PTVLEKYRMKEKYWSF--EK-IIYGKEYGYMDW-YEEGLNEIRSIK-----------------------------------
142 HHSearch 75.1718% -22 - C3 - - 5UXD ? A:[4-298] --------------PED-LDALLDLAARHGLDL------DGGTLRTEE--IGLD-FRVAFA----RAHDG--------GDWVLRLPRRPD----V-LER-AAVEGRLLAML-AP-H--LDVAVPDWRIST---------------SELIAYPLLPGSPGLTV---A---A----------DGEVSWHVD---MASTVYARSLGSVVA-QLHA-VDA-----EA--AA-AT----G-----I-EV-------RSPAQVRG---A-WRQDLAR-----V--GAE-------FE---IAPALRERWEAWLADD-GCW--PG-HS----VLTHGELYPAHTLVED----E---R---ITAVLDWTTAAV-GDPAKDL--MFHQVS----A--------------------P-----SAI---F--------------------EVALQAYAE-----GG---GRPW--------PGLAR--HCTEMFSAAPLGY-GLYALATGEAAH-REAAAAALNPPE-----------------------------------
146 HHSearch 74.8318% -19 - C3 - - 5IGI ? A:[5-299] -------------TTAD-TSQLYALAAR-HGLK------LHGPLTVNE--LGLD-YRIVIATVDDG------------RRWVLRIPRRAE----V-SAK-VEPEARVLAML-KN-R--LPFAVPDWRVANAELVAY------PMLEDSTA-VIQPGSSTPDW---V--------------V-------P---QDSEVFAESFATALA-ALHA-VPI-----SA--AV-DA----G-ML--I----------RTPTQARQ---K-VADDVDR-----V--RRE-------FV---VNDKRLHRWQRWLDDD-SSW--PD-FS----VVVHGDLYVGHVLIDNT---E---R---VSGMIDWSEARV-DDPAIDM--AAHLMV----F--------------------G-----EEG---L--------------------AKLLLTYEA-----AGGRVW-----------PRLAHHIAERLAFGAV--TY-ALFALDSGNEEY-LAAAKAQLAA-------------------------------------
145 HHSearch 73.9918% -17 - C3 - - 5IGH - ? A:[5-299] -------------TTAD-TSQLYALAAR-HGLK------LHGPLTVNE--LGLD-YRIVIATVDDG------------RRWVLRIPRRAE----V-SAK-VEPEARVLAML-KN-R--LPFAVPDWRVANAELVAY------PMLEDSTAMVIQPGSSTPDW---V--------------V-------P---QDSEVFAESFATALA-ALHA-VPI-----SA--AV-DA----G-ML--I----------RTPTQARQ---K-VADDVDR-----V--RRE-------FV---VNDKRLHRWQRWLDDD-SSW--PD-FS----VVVHGDLYVGHVLIDNT---E---R---VSGMIDWSEARV-DDPAIDM--AAHLMV----F--------------------G-----EEG---L--------------------AKLLLTYEA-----AGGRVW-----------PRLAHHIAERLAFGAV--TY-ALFALDSGNEEY-LAAAKAQLAA-------------------------------------
149 HHSearch 70.7119% -12 - C3 - - 6EF6 ? A:[27-320] ------------------DVTIAQQALTHYDVS------DNASLRLLN---LSE-NATYLV----EDGE---------HQSILRVHRQDY----HQPHE-IESELDWLAAL-RT-D--SDVTVPTVVPARDGRRVVTVDPAD-VPRHVVHFEMVGGAEPDEE---S---L----------T--------------LDDFQTLGRITA-SLHE-HSQ-----RW--TR-PA----GFGR--F-SW--------DWEHCLGDTPR-WGRWQDA-----EGVGASE------TA---LLTRAQDLLHRKLEEY-GSG--PD-RY----GLIHADLRLANLLVDS----STPQR---TITVIDFDDCGF-GWYFYDF--GTAVSF----I--------------------EHDPRLGEW---Q--------------------ESWVAGYRSRRE--L----P-----------AADEAMLPSFVFLRRL--LL-LAWMGS------------------------------------------------------
160 Fugue 65.5015% -3 - C3 - - 3HAM ? A:[1-299] ----------------M-VNLDAEIYEHLNKQI------KINELRYLSS--GDD-SDTFLC----N------------EQYVVKVPKRDS----V-RIS-QKREFELYRFL-ENCK--LSYQIPAVVYQSDR---------------FNIMKYIKGERITYE---Q---Y----------H-------KLSEKEKDALAYDEATFLK-ELHS-IEI-----DC-SVS-LF----S-DA--L-VNK------KDKFLQDK---K-LLISILE-----K--EQL-------LTDE-MLEHIETIYENILNN--AVL--FKYTP----CLVHNDFSANNMIFRN----N---R---LFGVIDFGDFNV-GDPDNDF--LCLLDC----S--------------------T-----DDF---G--------------------KEFGRKVLKYYQHKA----P-----------EVAERKAELNDVYWSI--DQIIYGYERK-DREM-LIKGVSELLQTQAEMFIF-----------------------------
150 HHSearch 64.7512% 6 - C3 - - 3JR1 ? A:[14-308] ----------NLYFQGM-WKSISQVLAEQFGAYY-----FIKHKEKLY--SGEM-NEIWLI----NDEV---------QTVFVKINERSY------RSM-FRAEADQLALL-AK-T--NSINVPLVYGIGNS-----------QGHSFLLLEALNKSKNK-----------------------------------QSSFTIFAEKIA-QLHQ-IQG-----PDKYGL-DFDTWLGPIYQPN-DWQ------TSWAKFFSEN-R-IGWQLQI-----C--KEK-------GLIFGNIDLIVQIVADTLSK----H--NP-KP----SILHGNLWIENCIQVD----D---K---I-FVCNP-ACYW-GDRECDI--AFSSLF----E---------------------------PF---P--------------------TNFYQRYNEIYP--L----E-----------EGYLERKLIYQLYYLL--NF-SYRYYNK-KQSY-VSLTQKLINQILH----------------------------------
151 HHSearch 63.2214% -11 - C3 - - 4DCA ? A:[25-313] ---------------LD-AEIYEHLNK----QI------KINELRYLS--SGDD-SDTFLC----N------------EQYVVKVPKRDS----V-RIS-QKRELELYRFL-EN-CK-LSYQIPAVVYQS---------------DRFNIMKYIKGERITYEQYHK---L----------S-------E---KEKDALAYDEATFLK-ELHS-IEI-----DC-SVS-LF----S-----D-ALV------NKKDKFLQ---D-KKLLISI-----L--EKEQL-----LTD--EMLEHIETIYENILSNAVLF--KY-TP----CLVHNDFSANNMIFRN----N---R---LFGVIDFGDFNV-GDPDNDF--LCLLDCSTDDF--------------------G-----KEF---G--------------------RKVLKYYQHK----A----P-----------EVAERKAELNDVYWSI--DQ-IIYGYERKDREMLIKDVSELLQT-------------------------------------
173 Fugue 62.7112% 13 - C3 - - 3JR1 ? A:[14-309] -----------NLYFQGMWKSISQVLAEQFGA-------YYFIKHKEKL-YSGEMNEIWLINDE-V------------QTVFVKINE--R----S-YRSMFRAEADQLALL-AK-T--NSINVPLVYGIGNSQ-----------GHSFLLLEALNKSKNKQ-------------------------------SSFTIFAEKIAQLHQ-IQGP-DKYGLDFDTW-LGP-IY----Q-PN--D-WQT------SWAKFFSE---NRIGWQLQI-----C--KEK-------G----LIFGNIDLIVQIVAD--TLSKHNP-KP----SILHGNLWIENCIQVD----D-------KIFVCNPACYWGDRECDIAF--SSLFEP----F--------------------P-----TNF---Y--------------------QRYNEIYP------L----E-----------EGYLERKLIYQLYYLL--NF-SYRYYNK-KQSY-VSLTQKLINQILHK---------------------------------
148 HHSearch 62.1412% -17 - C3 - - 5IWU ? A:[3-299] ---------------KD-IKQVIEIAKKHNLFL------KEETIQFNE--SGLD-FQAVFA----QDNNG--------IDWVLRLPRRED----V-MPR-TKVEKQALDLV-NK-YA-ISFQAPNWIIYT---------------EELIAYKKLDGVPAGTI---D---HNIGNYIWEIDI-------N---NVPELFHKSLGRVLA-ELHS-IPS-----NK--AA-AL----D-LV--V-H---------TPEEARM---S-MKQRMDA-----V--RAK-------FG---VGENLWNRWQAWLNDD-DMW--PK-KT----GLIHGDVHAGHTMIDKD---A---N---VTGLIDWTEAKV-TDVSHDF--IFNYRA----F--------------------G-----EEG---L--------------------EALILAYKE-----IG---GYYW--------PKMKEHIIELNAAYPV--SI-AEFALVSGIEEY-EQMAKEALEV-------------------------------------
147 HHSearch 61.6612% -17 - C3 - - 5UXA - ? A:[3-299] ---------------KD-IKQVIEIAKKHNLFL------KEETIQFNE--SGLD-FQAVFA----QDNNG--------IDWVLRLPRRED----V-MPR-TKVEKQALDLV-NK-YA-ISFQAPNWIIYT---------------EELIAYKKLDGVPAGTI---D---HNIGNYIWEIDI-------N---NVPELFHKSLGRVLA-ELHS-IPS-----NK--AA-AL----D-LV--V-H---------TPEEARM---S-MKQRMDA-----V--RAK-------FG---VGENLWNRWQAWLNDD-DMW--PK-KT----GLIHGDVHAGHTMIDKD---A---N---VTGLIDWTEAKV-TDVSHDF--IFNYRA----F--------------------G-----EEG---L--------------------EALILAYKE-----IG---GYYW--------PKMKEHIIELNAAYPV--SI-AEFALVSGIEEY-EQMAKEALEV-------------------------------------
144 HHSearch 61.4110% -10 * C3 * - 5IQC AACA_STAAU A:[6-303] -----------DDNATN-VKAMKYLIEHYFDNF------KVDSIEIIG--SGYD-SVAYLV----N------------NEYIFKTKFSTN----K-KKG-YAKEKAIYNFL-NT-NLETNVKIPNIEYSYISD-----------ELSILGYKEIKGTFLTPEIYST---M----------S-------E---EEQNLLKRDIASFLR-QMHG-LDY-----TD--IS-EC----T-ID--N--KQ------NVLEEYIL---L-RETIYND-----L--TD-------------IEKDYIESFMERLNAT-TVF--EG-KK----CLCHNDFSCNHLLLDGN---N---R---LTGIIDFGDSGI-IDEYCDF--IYLLEDSEEEI--------------------G-----TNF---G--------------------EDILRMYGNI----D----I-----------EKAKEYQDIVEEYYPI--ET-IVYGIKNIKQEF-IENGRKEIYKRTY----------------------------------
165 Fugue 61.0915% -3 - C3 - - 1ZYL - SRKA_ECOLI A:[4-328] -----SAFTF---QTLH-PDTIMDALFE----H------GIRVDSGLTPLNSYE-NRVYQFQDEDR------------RRFVVKFYRPERW---T-ADQ-ILEEHQFALQL-VNDE--VPVAAPVAFNGQTLLN--------HQGFYFAVFPSVGGRQFEAD--------------------------------NIDQMEAVGRYLG-RMHQ-TGR-----KQ-LFI-HR----P-TI--G-LNE------YLIEPRKL---F-EDATLIP-----S--GLK-------A----AFLKATDELIAAVTA--HWR--ED-FTV---LRLHGDCHAGNILWRD----G--------PMFVDLDDARN-GPAVQDL--WMLLNG----D--------------------K-----AEQ---R--------------------MQLETIIE------A----Y-----------EEFSEFDTAEIGLIEP--LR-AMRLVYY-LAWL-MRRWADPAFPKNFPWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY
175 Fugue 60.5420% -49 - C3 - - 4WW7 BUD32_YEAST A:[4-257] ---------------EF-IDKVSSYL----------------------T-PDVD-IAPISQ----G------------AAIVFTTTTHP-----------------YLPRA-KD------------------------------SHQKYIIKYRPRTLNESR---L---L----------A-------K---LYLIPGLCVPQLIACDPYNG-FIW-----LE-FLG-ED----L-PG--G-HGF------SNLK-NFL---W-MHDQ-DP-----Y--S----------------DLVATTLRKVGRQ--IGL--LH-WN----DYCHGDLTSSNIVLVR----D---GARWTPHLIDFGLGSV-SNLVEDK--GVDLYV----L--------------------E-----RAI---L--------------------STHSK-------------------------------HAEKYNAWIME--GF-EEVYREQ-G-AK-GAKKLKEVTKRFEEVRLRGRKR-------------------------
166 Fugue 60.3913% 13 - C3 - - 3ATS Y3168_MYCTU A:[1-357] TLPAVISRWLSSVLPGG-AAPEVTVESGVDSTG------MSSETIILTA-RWQQ-DGRSIQ----Q------------KLVARVAPAAEDVPVFP-TYR-LDHQFEVIRLV-GE-L--TDVPVPRVRWIETTGD--------VLGTPFFLMDYVEGVVPPDV---M---P----------Y-------T---FGDNWFADAPAERQR-QLQD-ATV-----AA-LATLHS----I-PN--A-QNTFSFLTDTTLHRHFN---W-VRSWYDF-----A--VEG-------I----GRSPLLERTFEWLQS--HWP--DD-AAAREPVLLWGDARVGNVLYRD----F---Q---PVAVLDWEMVAL-GPRELDV--AWMIFA----H--------------------R-----VFQ---ELAGLATLPGLPEVMREDDVRATYQALTG------V----E-----------LGDLHWFYVYSGVMWA--CV-FMRTGAR-RVHF-GEIEKPDDVESLFYHAGLMKHLLGEEH--------------------
143 HHSearch 60.3810% -14 - C3 - - 5IQI AACA_STAAU C:[9-303] --------------ATN-VKAMKYLIEHYFDNF------KVDSIEIIG--SGYD-SVAYLV----N------------NEYIFKTKFSTN----K-KKG-FAKEKAIYNFL-NT-NLETNVKIPNIEYSYISD-----------ELSILGYKEIKGTFLTPEIYST---M----------S-------E---EEQNLLKRDIASFLR-QMHG-LDY-----TD--IS-EC----T-ID--N--KQ------NVLEEYIL---L-RETIYND-----L--TD-------------IEKDYIESFMERLNAT-TVF--EG-KK----CLCHNDFSCNHLLLDGN---N---R---LTGIIDFGDSGI-IDEYCDF--IYLLEDSEEEI--------------------G-----TNF---G--------------------EDILRMYGNI----D----I-----------EKAKEYQDIVEEYYPI--ET-IVYGIKNIKQEF-IENGRKEIYKRTY----------------------------------
163 Fugue 59.8216% -5 - C3 - - 2PPQ - KHSE_AGRFC A:[5-320] -------------TDIT-EDELRNFLTQY-----------DVGSLTSYK-GIAE-NSNFLL----HTTK---------DPLILTLYEK-------------KNDLPFFLGLMQH-L--AAKGLSCPLPLPRKDG--------ELLGELS-----GRPAALIS---F---L----------E-------GM--WLRKPEAKHCREVGK-ALAAMHLA-----SE-GFE-IK----R-PN--A-LSV------DGWKVLWD---K-SEERADE-----V--EKG-------L----REEIRPEIDYLAAHW--PKD--LP-AG----VI-HADLFQDNVFFLG----D---E---LSGLIDFYFACN-DLLAYDVSICLNAWC----F--------------------E-----KDGAYNV--------------------TKGKALLE------G----YQSVRPL-----SEAELEALPLLSRGSA--LR-FFLTRLY-DWLT-TPAGALVVKKDPLEYLRKLRFHRTIANVAEYGLA-------------
152 HHSearch 58.2915% 4 - C3 - - 3HAM ? A:[16-291] --------------------------------I------KINELRYLS--SGDD-SDTFLC----N------------EQYVVKVPKRDS----V-RIS-QKREFELYRFL-EN-CK-LSYQIPAVVYQS---------------DRFNIMKYIKGERITYE---QYHKL----------S-------E---KEKDALAYDEATFLK-ELHS-IEI-----DC-SVS-LF----S--D--A--LV------NKKDKFLQ---D-KKLLISI-----L--EKEQL-----LTD--EMLEHIETIYENILNNAVLF--KY-TP----CLVHNDFSANNMIFRN----N---R---LFGVIDFGDFNV-GDPDNDF--LCLLDCSTDDF--------------------G-----KEF---G--------------------RKVLKYYQHK----A----P-----------EVAERKAELNDVYWSI--DQ-IIYGYERKDREM-LIKGVSELLQ-------------------------------------
155 HHSearch 56.7814% -6 - C3 - - 1NW1 - CKA2_CAEEL B:[52-394] ----------------L-KERAHMLCARFLGGAWKTVPLEHLRISRIK--GGMS-NMLFLC----RLSEVYPPIRNEPNKVLLRVYFNPE----T-ESH-LVAESVIFTLL-SE-R---HLG-PKLYGIFS---------------GGRLEEYIPSRPLSCH---E---I----------S-------------LAHMSTKIAKRVA-KVHQ-LEV-----PI--WK-EP----D-------YLC------EALQRWLK---Q-LTGTVDAEHRFDL--PEECGVSSVNCL---DLARELEFLRAHIS----LS--KS-PV----TFCHNDLQEGNILLPK------------RLVLIDFEYASY-NYRAFDF--ANHFIE----WTIDYDIDEAPFYKIQTENFPE-----NDQ---M--------------------LEFFLNYLRE----Q----GNTRENELYKKSEDLVQETLPFVPVSHF--FW-GVWGLLQ-----------------------------------------------------