@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A4BIV1_9GAMM: (2019-01-25 )
MSVYTELSEQDVMHLLADYDLGVYVRHQGISAGVENTNYFVSTDQHELVLTVFEKHSADELPFFLQLGEHLHARHCKVPQPFRDRDGQFLQIVKGKPAVFIERLTGQHVQASPACALKIAQALADIHNATLSFQTDQRHSHNRGWIERQASRVLPSLSAPDQQLMNAALAIIRAIPDDLPEGVIHADLFHDNALFDGNEVAGIIDWYFAGRDSYALDIAITMNDWCLDTQHQVDPEQCAAFIERYHQRRSLSSAERNALPKLQVQSALRFWISRLLAQAEHGESNDSITVKDPIPMREQCRQLLTRVREPGNEHR

Atome Classification :

(21 SA) ------------------------------.......-.-----.10........------20-.-.......30....-....40.--..---------.-.-.---------..50..-.------..----.---..-60.-.---.....-----.-.70..-.-...-..80......----..90...-----.....100......-.------------------..110--.--------------...--.....120.....-----..130.--.-----------...-----..-140--.---.-----..-------.------.---...150--.-.---..------------.-----------.--.-------.----.160--------.---..---.--------------.-....170..-------.-----.--.----..-----180----.---.......190---.......--.---.200..--.....210.......220....---..------------.230----------..------------..-----...--------..240.....--.------.------250.......260---...--.....270...---....280...-...-.290.......300.......310...--------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ------------------------------MSVYTEL-S-----EQDVMHLLADY------DL-G-VYVRHQGISAGVE-NTNYFVS--TD---------Q-H-E---------LVLTVF-E------KH----S---AD-E-L-P---FFLQL-----G-EHLHA-R-HCK-VPQPFRDRDG----QFLQIVK-----GKPAVF--IERLTG-Q------------------HVQ----A--------------SPA--CALKIAQALADIH-----NATLSF--Q-----------TDQ-----RH-S----H---N-----RG-------W------I---ERQA----S-R---VL------------P-----------S--L-------S----AP----------D---QQ---L--------------M-NAALAIIRA-------I-----P--D----DL-----PE-----G---VIHADLFH-----DNALFDG--N---EVAGII--DWYFAGRDSYALDIAITMNDWC---LD------------TQ------------HQ------------VD-----PEQ--------CAAFIERYHQ--R------R------SLSSAERNALPK----LQV--QSALRFWISRL---LAQAEHGESN-DSI-TVKDPIPMREQCRQLLTRVREPGNEHR--------
21 HHSearch 88.1134% -31 - C2 - - 2PPQ - KHSE_AGRFC A:[5-311] ----------------------------------TDI-T-----EDELRNFLTQY------DV-G-SLTSYKGIAE----NSNFLLH--TT---------K-D-P---------LILTLY-E------K---------KN-D-L-P---FFLGL-----M-QHLAA-K-GLS-CPLPLPRKDG----ELLGELS-----GRPAAL--ISFLEG-M------------------WLR----KP-------------EAK--HCREVGKALAAMH-----LASEGF--E------------IK-----RP-N----A---LS----VD-------G------W---KVLW----D-K---SE------------ERAD--------E--V-------E----KG----------L---RE---E--------------I-RPEIDYLAA-------H-----WP-K----DL-----PA-----G---VIHADLFQ-----DNVFFLG--D---ELSGLI--DFYFACNDLLAYDVSICLNAWC---FE------------KD------------GA------------YN-----VTK--------GKALLEGYQS--V------R------PLSEAELEALPL----LSR--GSALRFFLTRL---YDW--LTTPAGALV-VKKDPLEY---LRKLRFHRTI--------------
1 PsiBlast_PDB 86.0436% -59 - C2 - - 2PPQ - KHSE_AGRFC A:[5-281] ----------------------------------TDI-T-----EDELRNFLTQY------DV-G-SLTSYKGIAE----NSNFLLH--TT---------K-D-P---------LILTLY-E------K---------KN-D-L-P---FFLGL-----M-QHLAA-K-GLS-CPLPLPRKDG----ELLGELS-----GRPAAL--ISFLEG-M------------------WLR----K--------------PEAKHCR-EVGKALAAMH-----LASEGF--E-----------IKR-----PN-A----L---SV----DG-------WKVLWDKS---EERA----D-E---VE------------K-----------G--L-------R--------------------EE---I--------------R-PEIDYLAAH-------W-----P--K----DL-----PA-----G---VIHADLFQ-----DNVFFLG--D---ELSGLI--DFYFACNDLLAYDVSICLNAWC---FE------------KD------------GA------------YN-----VTK--------GKALLEGYQS--V------R------PLSEAELEALPL----LSR--GSALRFFLTRL-----------------------------------------------------
42 Fugue 83.6532% -14 - C2 - - 2PPQ - KHSE_AGRFC A:[5-320] ----------------------------------TDI-T-----EDELRNFLTQY------DV-G-SLTSYKGIA---E-NSNFLLH--TT---------K-D-P---------LILTLY-E------KK---------N-D-L-P---FFLGL------MQHLAA-K-GLS-CPLPLPRKDG----ELLGELS-----GRPAAL--ISFLEGMW------------------LRK----P--------------EAK--HCREVGKALAAMH-----LASEGF--E-----------IKR-----PN-A----L---S-----VD-------G------W---KVLW----D-K---SE------------E-----------R--A-------D----EV----------E---KG---L--------------R-EEIRPEIDY-------L-----A--AHWPKDL-----PA-----G---VIHADLFQ-----DNVFFLG--D---ELSGLI--DFYFACNDLLAYDVSICLNAWC---FE------------KD------------GA------------YN-----VTK--------GKALLEGYQS--V------R------PLSEAELEALPL----LSR--GSALRFFLTRL---YDWLTT-PAG-ALV-VKKDPLEYLRKLRFHRTIANVAEYGLA--------
24 HHSearch 58.7915% -67 - C2 - - 2Q83 COTI_BACSU A:[22-305] ----------------------------------------------LAENVLQGW------DV---QAEKIDVIQ-----ALVWKVH--TD---------S-G-A---------VCLKRI-H------RP--------EK-K-A-L---FSIFA-----Q-DYLAK-K-GMN-VPGILPNKKG----SLYSKHG-----SFLFVV--YDWIEG-R------------------PFE----LT-------------VKQ--DLEFIMKGLADFH-----TASVGY--Q------------PP-----NG-VP---I---FTK---LG-------R------W---PNHYTKRCK-Q---ME------------TWKLMAEAEKEDP--FSQLY---L----QE----------IDGFIE---D--------------G-LRIKDRLLQSTYVPWTE-----Q--L----KK-----SP-----N---LCHQDYGT-----GNTLLGE--N---EQIWVI--DLDTVSFDLPIRDLRKMIIPLL---DT------------T-------------GV------------WD-----DET--------FNVMLNAYES--R------A------PLTEEQKQVMFI----DML--F---------------------------------------------------------------
43 Fugue 55.8415% 9 - C2 - - 1ZYL - SRKA_ECOLI A:[4-328] -----------------------------SAFTFQTL-H-----PDTIMDALFEH------GI-R-VDSGLTPLN-SYE-NRVYQFQ--DE---------DRR-R---------FVVKFY-R------PERW--T---AD-Q-I-L---EEHQF-----A-LQLVN-D-EVP-VAAPVA-FNG----QTLLNHQ-----GFYFAV--FPSVGG-R------------------QFE----AD-------------NID--QMEAVGRYLGRMH-----QTGRKQ--L-----------FIH-----RP-T----I---G-----LN-------E------Y---LIEP----R-K---LFEDATLIP-----S-----------G--L-------K----AA----------F---LK---A--------------T-DELIAAVTA-------HW----R--E----DF-----TV-----L---RLHGDCHA-----GNILWRD--G-----PMFV--DLDDARNGPAVQDLWMLLNGD--------------------------------KA------------EQ-----RMQ--------LETIIEAYEE--F------S------EFDTAEIGLIEP----LRAMRLVYYLAWLMRR---WADPAFPKNF-PWLTGEDYWLRQTATFIEQAKVLQEPPLQLTPMY-----
59 SP3 54.3615% 1 - C2 - - 1NW1 - CKA2_CAEEL A:[32-426] ----------------------GMKELLSTMDLDTDA-NTIPELKERAHMLCARFLGGAWKTV-PLEHLRISRIKGGMS-NMLFLCR--LS---------E-V-YPPIRNEPNKVLLRVYFN------PE----T---ES-H-L-V---AESVI-----F-TLLSE-R-HL--GPKLYGIFSG-------------------GRL--EEYIPS-R------------------PLS----CHEIS----------LAH--MSTKIAKRVAKVH-----QLEVPI--W-----------KEP-----DY-L----C---EA----LQ-------R------W---LKQL----T-G---TV------------DAEHRFDLPEECG--V-------S----SV----------N---CL---D--------------L-ARELEFLRA-------H-----I--S----LSKS---PV-----T---FCHNDLQE-----GNILLPK--R-----LVLI--DFEYASYNYRAFDFANHFIEWT---ID------------YD------------IDEAPFYKIQTENFPE-----NDQ--------MLEFFLNYLR--E------QGNTRENELYKKSEDLVQE----TLP--FVPVSHFFWGV---WGLLQVELSP-VGF-------GFADYGRDRLSLYF-----KHKQLLKNLA
54 Fugue 53.7818% 16 - C2 - - 4OCV ? A:[24-378] --------------------------------------T-----NEALFDVASHF------AL-E-GTVDSIEPYGDGHINTTYLVT--TD---------G-P-R---------YILQRM-N------TGIFPDT---VN-L-M-R---NVELV-----T-STLKA-Q-GKE-TLDIVRTTSGD---TWAEIDG-----GAWRVYKFIEHTMS-Y------------------NLV----P--------------NPD--VFREAGRAFGDFQ-----NFLSGF--D-----------ANQLTETIAH-F----H---D-----TP-------H------R---FEDF----K-K---AL------------AADELGRA----A--G-------C----GP----------E---IE---F--------------Y-LSHADQYAV-------V-----M--D----GL-----RD-----G---SIPLRVTHNDTKLNNILMDA--TTG-KARAII--DLDTIMPGSMLFDFGDSIRFGASTALE------------DE------------RD------------LDKVHFSTEL--------FRAYTEGFVG--E------LRD----SITAREAELLPFSGNLLTM--ECGMRFLADYLEGDVYFATKYPEH-NLV-RSRTQIKLVREMEQRADETRAIVADVMETT-----
23 HHSearch 53.7621% -7 - C2 - - 6EF6 ? A:[27-309] --------------------------------------D-----VTIAQQALTHY------DV-S-DNASLRLL-NLSE-NATYLVE--DG---------E-H-Q---------SILRVH-R------QDYH--Q---PH-E-I-E---SELDW-----L-AALRTDS-DVT-VPTVVPARDG----RRVVTVDPADV-PRHVVH--FEMVGG-A------------------EPD----EESL-----------TLD--DFQTLGRITASLH-----EHSQRW--T------------RP-----AG-F----GRFSWD----WE-------H------C---LGDT----P-RWGRWQ------------D-----------AEGV-------G----AS----------E---TA---L--------------L-TRAQDLLHRKLEE---YG----S--G----PD-----RY-----G---LIHADLRL-----ANLLVDS--STPQRTITVI--DFDDCGFGWYFYDFGTAVSFIE---HD---------------------------P------------RL-----GEW--------QESWVAGYRS--R------R------ELPAADEAMLPS----FVF--L---------------------------------------------------------------
47 Fugue 52.1413% 9 - C2 - - 1NW1 - CKA2_CAEEL A:[32-426] ----------------------GMKELLSTMDLDTDA-N-----TIPELKERAHM------LC-A-RFLGGAWKTVPLE-HLRISRI--KG---------G-M-S---------NMLFLC-RLSEVYPPI----R---NE-P-N-K---VLLRVYFNPET-ESHLV-A-ESV-IFTLLSERHL----GPKLYGI-----FSGGRL--EEYIPS-R------------------PLSCHEIS--------------LAH--MSTKIAKRVAKVH-----QLEVPIWKE-----------PDY-----LC-E----A---L-----QR-------W------L---KQLT----G-T---VD------------A-----------E--H-------R----FDLPEECGVSSVN---CL---D--------------L-ARELEFLRA-------HIS---L--S----KS-----PV-----T---FCHNDLQE-----GNILLPK--R-----LVLI--DFEYASYNYRAFDFANHFIEWT---IDYDIDEAPFYKIQTE------------NF------------PE-----NDQ--------MLEFFLNYLR--EQGNTREN------ELYKKSEDLVQE----TLP--FVPVSHFFWGV---WGLLQVELSP-V-------GFGFADYGRDRLSLYFKHKQLLKNLA-----
26 HHSearch 51.7116% -12 - C2 - - 1ZYL - SRKA_ECOLI A:[7-274] --------------------------------TFQTL-H-----PDTIMDALFEH------GI-R-VDSGLTPL-NSYE-NRVYQFQ--DED--------R-R-R---------FVVKFY-R------PERW--T---AD-Q-I-L---EEHQF-----A-LQLVN-D-EVP-VAAPVA-FNG----QTLLNHQ-----GFYFAV--FPSVGG-R------------------QFE----AD-------------NID--QMEAVGRYLGRMH-----QTGRKQ--L------------FI-----HR-P----T---IG----LNE------Y------LIEPRKLF----E-D---AT------------------------L--I-------PSGLKAA----------F---LK---A--------------T-DELIAAVTA-------H-----WR-E----DF-----TV-----L---RLHGDCHA-----GNILWRD------G-PMFV--DLDDARNGPAVQDLWMLLNGDK---A-----------------------------------------EQ-----RMQ--------LETIIEAYEE--F------S------EFDTAEIGLIEP----LRA--MRL-------------------------------------------------------------
52 Fugue 50.0513% -12 - C2 - - 3JR1 ? A:[14-309] -------------------------------NLYFQGMW-----KSISQVLAEQF------GA-Y-YFIKHKEKLYSGEMNEIWLIN--DE---------V-Q-T---------VFVKIN-E------RS----Y---RSMF-R-A---EADQL-----A-LLAKT-N-SIN-VPLVYG----------IGNSQ-----GHSFLL--LEALNK-S--------------------K----N--------------KQS--SFTIFAEKIAQLH-----QIQGPD--KYGLDFDTWLGPIYQ-----PN-D----W---Q-----TS-------W------A---KFFS----ENR---IG------------W-----------Q--L-------Q----IC----------K---EKGL-I--------------F-GNIDLIVQI-------V-----A--D----TL-----SKHNPKPS---ILHGNLWI-----ENCIQVD--D---KIFVCN--PACYWG--DRECDIAFSSLFEP---FP-----------------------------------------------------------TNFYQRYNE--I------Y------PLEE---GYLER----KLI--YQLYYLLNFSY---RYYNKKQ--------------SYVSLTQKLINQILHK-------------
25 HHSearch 49.6616% 11 - C2 - - 4OCV ? A:[24-320] --------------------------------------T-----NEALFDVASHF------AL-EGTVDSIEPYGDGHI-NTTYLVT--TD---------G-P-R---------YILQRM-N------TG----IFPDTV-N-LMR---NVELV-----T-STLKA-Q-GKE-TLDIVRTTSG----DTWAEID-----GGAWRV--YKFIEH-T------------------MSY----NLVP-----------NPD--VFREAGRAFGDFQ-----NFLSGF--D------------AN-----QL-T----E---TIAH--FHDTPH---R------F---EDFK----K-A---LA------------ADELG-------R--AAG-----C----GP----------E---IE---F--------------Y-LSHADQYAVVMDG---LR----D--G----SI-----PL-----R---VTHNDTKL-----NNILMDATTG---KARAII--DLDTIMPGSMLFDFGDSIRFGA---ST------------ALEDERDLDK----VH------------FS-----TEL--------FRAYTEGFVGELR------D------SITAREAELLPF----SGN--LLT-------------------------------------------------------------
28 HHSearch 49.4619% -31 - C2 - - 5IGI ? A:[2-258] -------------------------------TVVTTA-D-----TSQLYALAARH------GL-K-LHGPLTVNELGLD-YRIVIAT--VDD--------G-R-R---------WVLRIP-R------RAE---V---SA-K-V-E---PEARV-----L-AMLKN-RLPFA-VPDWRVANA-----ELVAYPM-----LEDSTA---VIQPG-S------------------STP----DWVVPQD--------SEV--FAESFATALAALH-----AVPISA--A------------VD-----AGML----I---RTPTQARQ-------K------V---ADDV----D-R---VR------------R-----------E--F------------VV----------N---DK---R--------------L-HRWQRWLDD-------DS----S--W----PD-----FS-----V---VVHGDLYV-----GHVLIDNT-E---RVSGMI--DWSEARVDDPAIDMAAHLMVFG----------------------------------------------------EEG--------LAKLLLTYEA--A------G------GRV----------------------------------------------------------------------------------
49 Fugue 49.0813% 3 - C2 - - 2QG7 - ? A:[50-458] YPITESNLRILEGEDRSEKAKELLKKYVSNVFENEKT-L-----YIYCKYVMLHYGKDLV-NP-N-EVDSLEFQIINGT-NILIKVKDMSK---------Q-A-K---------YLIRLYGP------TD----E---II-N-R-E---REKKI-----S-CILYN-K-NIA-KKIYVFFTNG----RIEEFMD-----GYA--------LSR-E------------------DIK-------------------NPK--FQKLIAKNLKLLH-----DIKLNE--N-----------LYK-----EL-Q----V---T-----QKVPGTRPSF------L---WNTI----W-K---YF------------H-----------L--L-------N----EE----------R---KK---ICSFDAKANILKLIDF-DVLRDSIVE-------V-----E--S----LCKRENSPI-----V---LCHCDLLS-----SNIINTV--G---EGDSISFIDFEYSCPMERAYDIANHFNEYAGFNCD------------WD------------LT------------PS-----KEE--------EYHFIMHYLG--T------D------D-EELINQLIRE----IQP--FYICSHINWGL---WSLLQGMHSF-D----------FINYGMTRLTASCLPIFRSKV-------
22 HHSearch 48.6917% -28 - C2 - - 4PDY ? A:[25-301] ------------------------------------------------QAVVSKY------DL-A--IQQ---R---HA-DGNIEVW--TDS--------K-GRR---------YAAKRS-S-------I----A---PA-H-C-R---IMVQC-----L-RHAQE-Q-GFTKFARFVTTSSN----APYVRHG-----DFTYYV--TEWVSG-Q------------------PAN----FG-------------LPE--HVAQTAYTLAQFH-----EATRSF--R------------TD-----WK-----------DDV--FG-------L------F---QARW----R-D---LRQMWLGADRKREKD-----------A--FDQLLLSMR----DE----------L---HR---D--------------A-AESLALFEDRDVIA--YLE---A--E----RS-----SG-----G---WCHLDVIP-----SNCLYTP--Q---HQVVLI--DFELARPAPRALDMAHLLRRSL---ER------------G--------------N------------WD-----GHL--------AYACFLHFDA--V------R------NIPKSEYRAVEA----ILR--F---------------------------------------------------------------
27 HHSearch 46.0817% 5 - C2 - - 4WH3 NAHK_BIFL2 A:[4-299] --------------------------------------S-----NEVLFGIASHF------ALEG-AVTGIEPYGDGHI-NTTYLVT--TD---------G-P-R---------YILQQM-N------TS----IFPDTV-NLM-R---NVELV-----T-STLKA-Q-GKE-TLDIVPTTSG----ATWAEID-----GGAWRV--YKFIEH-T------------------VSY----NLVP-----------NPD--VFREAGSAFGDFQ-----NFLSEF--D------------AS-----QL-T----E---TIAH--FHDTPH---R------F---EDFK----A-A---LA------------ADKL--------G--R-------A----AA----------C---QPEIDF--------------Y-LSHADQYAV-------VMDGLRD--G----SI-----PL-----R---VTHNDTKL-----NNILMDATTG---KARAII--DLDTIMPGSMLFDFGDSIRFGA---ST------------ALEDEKDLSK----VH------------FS-----TEL--------FRAYTEGFVGELR------G------SITAREAELLPF----SGN--LL--------------------------------------------------------------
40 HHSearch 45.3318% 7 - C2 - - 1NW1 - CKA2_CAEEL B:[75-360] -------------------------------------------------------------------HLRISRIKGGMS-NMLFLCR--LSEVYPPIRNEP-N-K---------VLLRVY-F------NPE---T---ES-H-L-V---AESVI-----F-TLLSE-R-HLG--PKLYGIFS-------------------GGRL--EEYIPS-R------------------PLS----CHEIS----------LAH--MSTKIAKRVAKVH-----QLEVPI--W------------KE-----PD-YL---C---EA----LQ-------R------W---LKQL----T-G---TV------------DAEHRF------D--L-------P----EECGVSSV----N---CL---D--------------L-ARELEFLRA-------H-----ISLS----KS-----PV-----T---FCHNDLQE-----GNILLPK-------RLVLI--DFEYASYNYRAFDFANHFIEWT---ID------------YDIDEAPFYKIQTENF------------PE-----NDQ--------MLEFFLNYLR--E------Q------GNT----------------------------------------------------------------------------------
41 HHSearch 44.2318% 12 - C2 - - 1NW1 - CKA2_CAEEL A:[75-360] -------------------------------------------------------------------HLRISRIKGGMS-NMLFLCR--LSEVYPPIRNEP-N-K---------VLLRVY-F------NPE---T---ES-H-L-V---AESVI-----F-TLLSE-R-HLG--PKLYGIFS-------------------GGRL--EEYIPS-R------------------PLS----CHEIS----------LAH--MSTKIAKRVAKVH-----QLEVPI--W------------KE-----PD-YL---C---EA----LQ-------R------W---LKQL----T-G---TV------------DAEHRF------D--L-------P----EECGVSSV----N---CL---D--------------L-ARELEFLRA-------H-----ISLS----KS-----PV-----T---FCHNDLQE-----GNILLPK-------RLVLI--DFEYASYNYRAFDFANHFIEWT---ID------------YDIDEAPFYKIQTENF------------PE-----NDQ--------MLEFFLNYLR--E------Q------GNT----------------------------------------------------------------------------------
45 Fugue 43.6614% -21 - C2 - - 3ATS Y3168_MYCTU A:[1-357] -------------------------------TLPAVI-S-----RWLSSVLPGGA------AP-E-VTVESGVDSTGMS-SETIILT--AR---------W-Q-Q---------DGRSIQ-Q------KL----V---AR-V-A-PAAEDVPVF-----P-TYRLD-H-QFE-VIRLVGELTDVPVPRVRWIETTGDVLGTPFFL--MDYVEG-VVPPDVMPYTFGDNWFADAPAE----R--------------QRQ--LQDATVAALATLHSIPNAQNTFSF--L-----------TDT-----TL-H----R---H-----FN-------W------V---RSWY----D-F---AV------------E-----------G--I-------G-----R----------S---PL---L--------------E-RTFEWLQSH-------W-----P--D----DA-----AA-----REPVLLWGDARV-----GNVLYRD--F---QPVAVL--DWEMVALGPRELDVAWMIFAHR---VF------------QE------------LA------------GL-----ATLPGLPEVMREDDVRATYQA--L------T------GVE------LGD----LHW--FYVYSGVMWAC---VFMRTGARRV-HFG-EIEKPDDVESLFYHAGLMKHLLGEEH---------
39 HHSearch 41.2214% -26 - C2 - - 5UXD ? A:[3-256] ----------------------------------MPE-D-----LDALLDLAARH------GL-DLDGGTLRTEEIGLD-FRVAFAR--AHD--------G-G-D---------WVLRLP-R------RPD---V---LE-R-A-A---VEGRL-----L-AMLAPHL-DVA-VPDWRIST-------------------SELIA--YPLLPG-S------------------PGL----TVAADGEVSWHVDMASTV--YARSLGSVVAQLH-----AVDAEA--A------------AA-----TGIEVRSPA---QV----RG-------A------W---RQDL----A-R---VG------------A-----------E--F-------------E----------I---AP---A--------------LRERWEAWLAD-------DG----C--W----PG-----HS-----V---LTHGELYP-----AHTLVED--E---RITAVL--DWTTAAVGDPAKDLMFHQVSA-----------------------------------------------P-----SAI--------FEVALQAYAE--G------G------GRPW---------------------------------------------------------------------------------
32 HHSearch 36.4815% 17 - C2 - - 4R78 ? A:[38-260] ------------------------------------------------------------------EVLSVEQL-GGMT-NQNYLAK--TT---------N-K-Q---------YIVKFF-G------KG----TEK-LI-N-R-Q---DEKYN-----L-ELLKD-L-GLD-VKNYLFDIE------------------AGIKV--NEYIES-AI-----------------TLD----STS------------IKT--KFDKIAPILQTIH-----TSAKEL--R------------GE-----FA-P----F---EE----IK-------K------Y---ESLI----E-E---QI-----------------------------------P----YA----------N---YE---S--------------V-RNAVFSLEK-------R-----L--ADL--GV-----DR-----K---SCHIDLVP-----ENFIESPQ-G---R-LYLI--DWEYSSMNDPMWDLAALFLESE---------------------------------------------FT-----SQE--------EETFLSHYES--D------Q------TPVSHEKI-----------------------------------------------------------------------------