@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A6CIE6_9BACI: (2019-01-26 )
MNQAQFEKVIEVLFPDIIIQEVTAYEKGWDNDIFIVNKEIVFRFPRSEEVASKVKDEIILLKHLAHKEPKLDIPRYKGIEMDGNLKCVKYNFMKGKSLSEIKNSRLDLHSAELLGDFLSRLHSIELSALKETNITSFHTDTYWENLYESAKTYVFPNITHSERAEIQQFYEDFSNNPIYSNVNKAVIHGDLTAANILYNKEEECVSGIIDFTDAQIADPAFDFAGLYWAYGPEFTKKLLTYYDGKDKTGIFERVQSFYGLQPIFHELIYAVKENHDVDWGSALERFQYLNSHR

Atome Classification :

(31 SA) ---.........10...-.....20........30....--.---.----.-.40..-----......-50........60........--70.-...--..--.----.80-.----------.-....----..90...---......100------..--.---.----------.-...------.110--.........120------------.......130.....---...140.--..----...---.---150--....--.---------.---...160----.....---..------..170......---.180.......190.....--..200-.-.......210.......220.------...---.----.----.----------------230---.........240....---...250--.......260.......270--.....-----..280.......290.--------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ---MNQAQFEKVIEVLF-PDIIIQEVTAYEKGWDNDIFI--V---N----K-EIVFR-----FPRSEE-VASKVKDEIILLKHLAHKEP--KLD-IPR--YK--G----IEM-D----------G-NLKC----VKY-NFM---KGKSLSE--------IK--N---S----------R-LDL------HS----AELLGDFLSRLH------------SIELSALK-ETNITS---FHTDTYW--EN----LYE---S---A----KTYV--F---------P---NITH------SERAE---IQ------QFYEDFSNNPI---YSNVNKAVIHGDLTAANIL--YNKE--E-ECVSGIIDFTDAQIADPAFDF------AGL---Y----W----A----------------Y-----GPEFTKKLLTYYDGKD---KTGIFE--RVQSFYGLQPIFHELIYAVK--ENHDV-----DWGSALERFQYLNSHR--------------------------
4 PsiBlast_PDB 78.0631% -3 - C1 - - 3TDW ? A:[4-287] ----NKLHYTTMIMTQF-PDISIQSVESLGEGFRNYAIL--V---N----G-DWVFR-----FPKSQQ-GADELNKEIQLLPLLVGCV---KVN-IPQ--YVYIG----KRS-D----------G-N-PF----VGY-RKV---QGQILGE--------DG--M---A----------V-LPD------DA----KDRLALQLAEFM------------N-ELSAFPVETAISA---GVPVTNL--KNKILLLSE---A---V----EDQV--F---------P---LLDE------SLRDY---LT------LRFQSYMTHPV---YTRYTPRLIHGDLSPDHFLTNLNSR--Q-TPLTGIIDFGDAAISDPDYDY------VYL---L----E----D----------------C-----GELFTRQVMAYRGEVD---LDTHIR--KVSLFV----TFDQVSYLLEGLRARDQ-----DWIS--------------------------------------
21 Blastp_CBE 77.7331% -0 - C1 - - 3TDV ? B:[4-287] ----NKLHYTTMIMTQF-PDISIQSVESLGEGFRNYAIL--V---N----G-DWVFR-----FPKSQQ-GADELNKEIQLLPLLVGCV---KVN-IPQ--YVYIG----KRS-D----------G-N-PF----VGY-RKV---QGQILGEDGMAVFPDDA--K---D----------R-LAL------QL----AEFMN---------------------ELSAFPVETAISA---GVPVTNL--KNKILLLSE---A---V----EDQV--F---------P---LLDE------SLRDY---LT------LRFQSYMTHPV---YTRYTPRLIHGDLSPDHFLTNLNSR--Q-TPLTGIIDFGDAAISDPDYDY------VYL---L----E----D----------------C-----GELFTRQVMAYRGEVD---LDTHIR--KVSLFV----TFDQVSYLLEGLRARDQ-----DWIS--------------------------------------
6 PsiBlast_PDB 77.5731% -5 - C1 - - 3TDV ? A:[4-287] ----NKLHYTTMIMTQF-PDISIQSVESLGEGFRNYAIL--V---N----G-DWVFR-----FPKSQQ-GADELNKEIQLLPLLVGCV---KVN-IPQ--YVYIG----KRS-D----------G-N-PF----VGY-RKV---QGQILGEDGMAVFPDDA--K---D----------R-LAL------QL----AEFMN---------------------ELSAFPVETAISA---GVPVTNL--KNKILLLSE---A---V----EDQV--F---------P---LLDE------SLRDY---LT------LRFQSYMTHPV---YTRYTPRLIHGDLSPDHFLTNLNSR--Q-TPLTGIIDFGDAAISDPDYDY------VYL---L----E----D----------------C-----GELFTRQVMAYRGEVD---LDTHIR--KVSLFV----TFDQVSYLLEGLRARDQ-----DWIS--------------------------------------
45 HHSearch 76.1327% -29 * C1 * - 3TDW ? A:[4-298] ----NKLHYTTMIMTQF-PDISIQSVESLGEGFRNYAIL--V---N----G-DWVFR-----FPKSQQ-GADELNKEIQLLPLLVGC-V--KVN-IPQ--YV--Y----IGKRS----------D-GNPF----VGY-RKV---QGQILGE--------DG--MAVLP----------DDAKD------RL----ALQLAEFMNELS------------AFPVETAI-SAGVP-------VTNL--KN----KIL---L---LSEAVEDQV--F---------P---LLDE------SLRDY---LT------LRFQSYMTHPV---YTRYTPRLIHGDLSPDHFL--TNLNSRQ-TPLTGIIDFGDAAISDPDYDY------VYL---L----E----D----------------C-----GELF-TRQVMAYRGEVD--LDTHIR--KV-SLFVTFDQVSYLLEGLR--ARDQD-----WISEGLELLEEDKA----------------------------
46 HHSearch 73.9827% -28 - C- - - 3N4U - ? A:[4-299] ---YTFDQVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNK-L--PLP-IPE--VV--F----TGM-PSET-------Y-QMSF----AGF-TKI---KGVPLTP--------LL--L---NNLP-------KQSQN------QA----AKDLARFLSELH------------SINISGFK-SNLV-----LDFREKI--NE----DNK---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---M----EDDE-E----------------Y-----GMEFVSKILNHYKHKD---IPTVLE--KY-RMKEKYWSFEKIIYGKE--YGYMD-----WYEEGLNEIRSIK-----------------------------
14 PsiBlast_PDB 73.1630% -20 - C1 - - 6CD7 - ? A:[9-288] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGF-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
22 Blastp_CBE 71.9931% -17 - C1 - - 4DTB ? B:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGY-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
12 PsiBlast_PDB 71.8530% -19 - C1 - - 4DT8 ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGF-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
23 Blastp_CBE 71.1631% -25 - C1 - - 4DTA ? B:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSF-AGMTKIKGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
5 PsiBlast_PDB 71.1630% -16 - C1 - - 4DTB ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGY-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
16 PsiBlast_PDB 70.4030% -22 - C1 - - 4DTA ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSF-AGMTKIKGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
13 PsiBlast_PDB 70.2130% -15 - C1 - - 4DT9 ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGF-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
11 PsiBlast_PDB 69.5330% -15 - C- - - 3N4U - ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGF-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
3 PsiBlast_PDB 68.4230% -17 - C1 - - 5C4L ? A:[28-307] -------QVEKAIEQLY-PDFTINTIQISGKGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSFAGFT---KIKGVPL--------TP--L---L----------L-NNLPKQSQNQA----AKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
7 PsiBlast_PDB 68.0029% -24 - C1 - - 3SG8 ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSFAGFT---KIKGVPL--------TP--L---L----------L-NNLPKQSQNQA----AKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
2 PsiBlast_PDB 67.8130% -22 - C1 - - 5C4K ? A:[28-307] -------QVEKAIEQLY-PDFTINTIQISGKGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSFAGFT---KIKGVPL--------TP--L---L----------L-NNLPKQSQNQA----AKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
8 PsiBlast_PDB 67.3529% -25 - C1 - - 3SG9 ? A:[8-287] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSFAGFT---KIKGVPL--------TP--L---L----------L-NNLPKQSQNQA----AKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
20 PsiBlast_PDB 67.1929% -12 - C1 - - 4DFU ? A:[29-286] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGF-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISLMEDD----E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLE--KYR-----------------------------------------------------------------------
1 PsiBlast_PDB 67.1130% -22 - C1 - - 4N57 ? A:[28-307] -------QVEKAIEQLY-PDFTINTIQISGKGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPE--VV--F----TGM-P----------S-ETYQ----MSFAGFT---KIKGVPL--------TP--L---L----------L-NNLPKQSQNQA----AKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISL---MEDD-E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLEKYRMKEKYWS---FEKIIYG-K--EYGYM-----DW----------------------------------------
49 HHSearch 65.5120% -11 - C1 - - 5IQC AACA_STAAU A:[11-302] ----NVKAMKYLIEHYF-DNFKVDSIEIIGSGYDSVAYL--V---N----N-EYIFK-----TKFSTN-KKKGYAKEKAIYNFLNTN-LETNVK-IPN--IE--Y----SYI-S----------D-ELSI----LGY-KEI---KGTFLTP--------EI--Y---STMS-------EEEQN------LL----KRDIASFLRQMH------------GLDYTDIS-ECTI-----DNKQNVL--EE----Y-I---L---L----RETI--Y---------N---DLTD------IEKDY---IE------SFMER-LNATT---VFEGKKCLCHNDFSCNHLL--LDG---N-NRLTGIIDFGDSGIIDEYCDF------IYL---L----EDSEEE----------------I-----GTNFGEDILRMYGNID---IEKAKE--YQ-DIVEEYYPIETIVYGIK--NIKQE-----FIENGRKEIYKRT-----------------------------
48 HHSearch 64.0920% -11 - C1 - - 5IQI AACA_STAAU C:[11-302] ----NVKAMKYLIEHYF-DNFKVDSIEIIGSGYDSVAYL--V---N----N-EYIFK-----TKFSTN-KKKGFAKEKAIYNFLNTN-LETNVK-IPN--IE--Y----SYI-S----------D-ELSI----LGY-KEI---KGTFLTP--------EI--Y---STMS-------EEEQN------LL----KRDIASFLRQMH------------GLDYTDIS-ECTI-----DNKQNVL--EE----YIL---L--------RETI--Y---------N---DLTD------IEKDY---IE------SFMER-LNATT---VFEGKKCLCHNDFSCNHLL--LDG---N-NRLTGIIDFGDSGIIDEYCDF------IYL---L----E----DSEEE------------I-----GTNFGEDILRMYGNID---IEKAKE--YQ-DIVEEYYPIETIVYGIK--NIKQE-----FIENGRKEIYKRT-----------------------------
19 PsiBlast_PDB 63.6529% -24 - C1 - - 4DFB ? A:[29-286] -------QVEKAIEQLY-PDFTINTIEISGEGNDCIAYE--I---N----R-DFIFK-----FPKHSR-GSTNLFNEVNILKRIHNKLP---LP-IPEVVFT--G----MPS-E----------TYQMSF----AGF-TKI---KGVPLTP--------LL--L---N----------N-LPK------QSQNQAAKDLARFLSELH------------SINISGFK-SNLVLD---FREKINE--DN------K---K---I----KKLL--S---------R---ELKG------PQMKK---VD------DFYRDILENEI---YFKYYPCLIHNDFSSDHIL--FDTE--K-NTICGIIDFGDAAISDPDNDF------ISLME------E----E----------------Y-----GMEFVSKILNHYKHKD---IPTVLE--KYR-----------------------------------------------------------------------
55 HHSearch 63.2022% -37 - C1 - - 3HAM ? A:[6-292] ---------AEIYEHLN-KQIKINELRYLSSGDDSDTFL--C---N----E-QYVVK-----VPKRDS-VRISQKREFELYRFLENCKL--SYQ-IPA--VV--Y----QS----------------DRF----NIM-KYI---KGERITY--------EQ--YHKLS----------EKEKD------AL----AYDEATFLKELH------------SIEIDCSV-SLFS-----DALVNKK--DK----FLQDKKL---L----ISILEKE---------Q---LLTD------EMLEH---IE------TIYENILNNAV---LFKYTPCLVHNDFSANNMI--FRN-----NRLFGVIDFGDFNVGDPDNDF------LCL---L----D----CSTDD------------F-----GKEFGRKVLKYYQHKA---PEVAER--KA-ELNDVYWSIDQIIYGYE--RKDRE-----MLIKGVSELLQT------------------------------
66 Fugue 62.4420% -13 - C1 - - 3HAM ? A:[1-299] ---MVNL-DAEIYEHLN-KQIKINELRYLSSGDDSDTFL--C---N----E-QYVVK-----VPKRDS-VRISQKREFELYRFLE--NC--KLS-YQI--PA--V----VYQ-S----------D-RFNI----MKY-IKG---ERITYEQ--------YHKLS---E----------K-EKD------AL----AYDEATFLKELH------------SIEIDCSV-SLFSDA---LVNKKDK--FL----QDK---K---L----LISI--L---------EKEQLLTD------EMLEH---IE------TIYENILNNAV---LFKYTPCLVHNDFSANNMI--FRNN-----RLFGVIDFGDFNVGDPDNDF------LCL---LDCSTD----D----------------F-----GKEFGRKVLKYYQHKA---PEVAER--KAEL-NDVYWSIDQIIYGYE--RKDRE-----MLIKGVSELLQTQAEMFIF-----------------------
52 HHSearch 61.8720% 3 - C1 - - 5IGI ? A:[8-298] ----DTSQLYALAAR-H-GLKLHGPLTVNELGLDYRIVI--A---TVDDGR-RWVLR-----IPRRAE-VSAKVEPEARVLAMLKNR-L--PFA-VPD--WR--V----ANA-EL---------V-AYPMLEDSTA--VIQ---PGSSTPD--------WV--V---P----------Q-DSE------VF----AESFATALAALH------------AVPISAAV-DAGMLI---RTP-TQA--RQ----KVA---D---D----VDRV--R---------R---EFVV-------NDKR---L-------HRWQRWLDDDS---SWPDFSVVVHGDLYVGHVL--IDN---T-ERVSGMIDWSEARVDDPAIDM------AAH---L----M----V----------------F-----GEEGLAKLLLTYEAAGGRVWPRLAH--HI-AERLAFGAVTYALFALD--SGNEE-----YLAAAKAQLA--------------------------------
56 HHSearch 61.5322% -16 - C1 - - 4DCA ? A:[36-312] -------------------QIKINELRYLSSGDDSDTFL--C---N----E-QYVVK-----VPKRDS-VRISQKRELELYRFLENCKL--SYQ-IPA--VV--Y----QS----------------DRF----NIM-KYI---KGERITY--------EQ--Y---HKLS-------EKEKD------AL----AYDEATFLKELH------------SIEIDCSV-SLFS-----DALVNKK--DK----FLQ---DKKLL----ISIL--EKE-------Q---LLTD------EMLEH---IE------TIYENILSNAV---LFKYTPCLVHNDFSANNMI--FRN-----NRLFGVIDFGDFNVGDPDNDF------LCL---L----DCSTDD----------------F-----GKEFGRKVLKYYQHKA---PEVAER--KA-ELNDVYWSIDQIIYGYE--RKDREM----LIKDVSELLQ--------------------------------
54 HHSearch 58.8018% 15 - C1 - - 5IWU ? A:[4-299] ----DIKQVIEIAKKHN-LFLKEETIQFNESGLDFQAVF--A---QDNN-GIDWVLR-----LPRRED-VMPRTKVEKQALDLVNKYAI--SFQ-APN--WI--I----YT----------------EEL----IAY-KKL---DGVPAGT--------ID--H---NIGNYIWEIDINNVPE------LF----HKSLGRVLAELH------------SIPSNKAA-ALDLVVHTPEEARMSM--KQ----RMD---A---V----RA------------------KFG--------VGEN---LW------NRWQAWLNDDD---MWPKKTGLIHGDVHAGHTM--IDK---D-ANVTGLIDWTEAKVTDVSHDF------IFN---Y----R----A----------------F-----GEEGLEALILAYKEIGGYYWPKMKE--HI-IELNAAYPVSIAEFALV--SGIEE-----YEQMAKEALEV-------------------------------
81 Fugue 49.4118% 8 - C1 - - 4OCV ? A:[24-378] ----TNEALFDVASHFA-LEGTVDSIEPYGDGHINTTYL--V---TTDGPR-YILQRMNTGIFPDTVN-LMRNVELVTSTLKA--QGKE--TLD-IVR--TT--SGDTWAEI-D----------G-GAWR----VYK-FIE---HTMSYNL--------VP--N---P----------D-VFR------EA----GRAFGDFQNFLS------------GFDANQLT-ET-IAH---FHDTPHR--FE----DFK---K---A----LAAD--E---------L---GRAA------GCGPE---IEFYLSHADQYAVVMDGLR---DGSIPLRVTHNDTKLNNIL--MDAT--T-GKARAIIDLDTIMPGSMLFDF------GDS---I----R----FGASTALEDERDLDKVHF-----STELFRAYTEGFVGEL---RDSITA--REAELLPFSGNLLTMECGMR--FLADYLEGDVYFATKYPEHNLVRSRTQIKLVREMEQRADETRAIVADVMETT
62 HHSearch 44.2115% -1 - C1 - - 6EF6 ? A:[29-317] -------TIAQQALTHY-DVSDNASLRLL-NLSENATYL--V---EDGE-H-QSILR-----VHRQDYHQPHEIESELDWLAALRTD-S--DVT-VPT--VV--P----ARD-GRRVVTVDPADV-PRHV----VHF-EMV---GGAEPDE--------ES--L-----------------TL------DD----FQTLGRITASLH------------EHSQRWTR-PAGF-------GRFSWDWEH----CLGDTPR---W----GRWQ--D---------AE--GVGA------SETALLTRAQ------DLLHRKLEEYG---SGPDRYGLIHADLRLANLL--VDSS--TPQRTITVIDFDDCGFGWYFYDF------GTA---V----S----F----------------IEHDPRLGEWQESWVAGYRSRREL-PAADEA--ML-PSFVFLRRLLLLAW---------------------------------------------------------
61 HHSearch 43.9915% -1 - C1 - - 3I1A ? B:[7-291] ----QAQQLIELLKVHY-G-IDIHTAQFIQGGADTNAFAYQA---DSES-K-SYFIK-----LKYGYH-----DEINLSIIRLLHDS----GIKEIIF--PI--H----TLE-AKLFQQL----K-HFKI----IAY-PFI---HAPNGFT--------QN--L-----------------TG------KQ----WKQLGKVLRQIH------------ETSVPISI-QQQLRK---EIYSPKW--RE----IVR---S---F----YNQI--EFDNSDDKLTA---AFKSFFNQNSAAIHR---LV------DTSEKLSKKIQ---PDLDKYVLCHSDIHAGNVL--VGN-----EESIYIIDWDEPMLAPKERDL------MFI---G----G----G----------------VGNVWNKPHEIQYFYEGYGEIN---V--DKT--IL-SYYRHERIVEDIAV---------------------------------------------------------
68 Fugue 39.2117% 40 - C1 - - 3I1A ? A:[3-330] KQPIQAQQLIELLKVHYGIDIHTAQFIQGGADTNAFAYQ--ADSES----K-SYFIK-----LKYGYH--DEINLSIIRLLHDSGIKEI--IFP-IHT--LE--A-----KL-F----------Q-QLKH----FKI-IAY---PFIHAPN--------GF--T---Q----------N-LTG------KQ----WKQLGKVLRQIHETSVPISIQQQLRKEIYSPK-WREIVR---SFYNQIE--FD----NSD---D---K----LTAA--F---------K---SFFN------QNSAA---IH------RLVDTSEKLSKKIQPDLDKYVLCHSDIHAGNVL--VGNE--E-S--IYIIDWDEPMLAPKERDLMFIGGGVGN---V----W----N----------------K-----PHEIQYFYEGYGEINV---DKTILS--YYRHERIVEDIAVYGQDLLS--RNQN-------NQSRLESFKYFKEMFDPNNVVEIAFATE-------------