@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A6FEQ4_9GAMM: (2019-01-26 )
MMKKVPEFVVQFSPESFSLTPVPGGLSNHNYRLQFQQHGLNNRYFVRQFSATYLGMDNDVELEYAAQIQAANIGLAPNVIVKHKQGMICDWVTGEHWDQTAQVRDENIEKLAQLVAMLHQQPMPSHHLDMVERLQHYYQTLNTEFKTVQLAQQLTLVIDLIEQHLPANRLGFCHHDMNPLNFIEDEQAKLYLLDWEFAAAGHCDFDIATLFQTFEWQDAQQALFIRYYNQYYPAAKVTFEQLDVMAVVVEMMTLLWCIVMYQQDKDATYLRLWQQSEYAITDKINRLSKELQWDQ

Atome Classification :

(20 SA) ---------------------------------------------.........10---....--.------.-...20........30.-...-----...------.----40........50.....---...60........70.---------....-..--------.80..--------------.----------.--....90....-..------..100----.-......110.......120..--..-.--.---------------.---------------130---.---..----......140-----...---------.-------------.-------------.----.-------.150------------..---......160-------------..----..--.--.--.170---........180.--...--.------..190.......200.......210..------------------.------------------.-------------------...220.-----------......230------...----.-------------.---------...--.-240.......250.......260.-.---.-....270.......280.......290...-
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ---------------------------------------------MMKKVPEFVV----QFSP--E------S-FSLTPVPGGLSNHNYR-LQF-----QQH------G----LNNRYFVRQFSATYLGM---DNDVELEYAAQIQAAN---------IGLA-PN--------VIVKH--------------K----------Q--GMICDWVTGE-HW------DQTAQ----V-RDENIEKLAQLVAMLHQQPMP--SH-H--L---------------D---------------M-----V---ER----LQHYYQTL------NTE---------F-------------K-------------T----V-------QLA-------------QQ---LTLVIDLIE-------------QH----LP--A--N--RLG----FCHHDMNPLNFI--EDE--Q------AKLYLLDWEFAAAGHCDFDIATLFQTF------------------E------------------W-------------------QDAQQAL-----------FIRYYNQ--------YYP----A-------------A---------KVT--F-EQLDVMAVVVEMMTLLWCIVMYQQ-D---K-DATYLRLWQQSEYAITDKINRLSKELQWDQ-
40 HHSearch 75.5316% -18 - C1 - - 2QG7 - ? D:[110-456] ------------------------------------------------------------------------S-LEFQIINGG-TNILIK-VKD-----MSK------------QAKYLIRLYGPKT-D------NREREKKISCILYN---------KNIA-KK--------IYVFF--------------T----------N--GRIEEFMDGY-AL------SREDI----K-NPKFQKLIAKNLKLLHDIKLN--EN-L--YKELQVTQKVPGTRPSF---------------L-----W---NT----IWKYFHLL------NEE---------RKKICSFDAKANILK-------------L----I-------DFD-------------VL---RDSIVEVES-------------LCK---RE--N--S--PIV----LCHCDLLSSNII--NTVG--------DSISFIDFEYSCPMERAYDIANHFNEYAGFNCDWDL---------T------------------P-------------------SKEEEYH-----------FIMHYLG--------TDD----E-------------ELI-------NQL--I-REIQPFYICSHINWGLWSLLQGMH-S---S-DFDFINYGMTRLTASCLPIFRS---------
21 Fugue 75.3116% -12 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] -----------------GMKELLSTMDLDTDANTIPELKERAHMLCARFLGGAWK----TVPL--E------H-LRISRIKGGMSNMLFL-CRLSEVYPPIR------N----EPNKVLLRVYFNP--ET---ESHLVAESVIFTLLSE---------RHLG-PK--------LYGIF--------------S----------G--GRLEEYIPSR-PL------SCHEI----S-LAHMSTKIAKRVAKVHQLEVPIWKE-P--D---------------Y---------------L-----C---EA----LQRWLKQL------TGT---------V-------------D-------------A----E-------HRFDLPEECGVSSVNCLD---LARELEFLR-------------AH----IS--LSKS--PVT----FCHNDLQEGNIL--LPK----------RLVLIDFEYASYNYRAFDFANHFIEW------------------T------------------IDYDIDEAPFYKIQTENFPENDQMLEF-----------FLNYLREQGNTRENELYK----K-------------S---------EDL--V-QETLPFVPVSHFFWGVWGLLQVEL-S---P-VGFGFADYGRDRLSLYFKHKQLLKNLA----
39 HHSearch 75.0616% -32 * C1 * - 2QG7 - ? E:[110-456] ------------------------------------------------------------------------S-LEFQIING-ITNILIK-VKD-----MSK------------QAKYLIRLYGPKT-DE---IINREREKKISCILYN---------KNIA-KK--------IYVFF--------------T----------N--GRIEEFMDGY-AL------SREDI----K-NPKFQKLIAKNLKLLHDIKLN--EN-L--YKELQVTQKVPGTRPSF---------------L-----W---NT----IWKYFHLL------NEE---------RKKICSFDAKANILK-------------L----I-------DFD-------------VL---RDSIVEVES-------------LCK---RE--N--S--PIV----LCHCDLLSSNII--NTVGG-------DSISFIDFEYSCPMERAYDIANHFNEYAGFNCDWDL---------T------------------P-------------------SKEEEYH-----------FIMHYLG--------TDD----E-------------ELI-------NQL--I-REIQPFYICSHINWGLWSLLQGMH-S---S-DFDFINYGMTRLTASCLPIFRS---------
37 HHSearch 74.1916% -22 - C1 - - 1NW1 - CKA2_CAEEL A:[74-425] -----------------------------------------------------------------E------H-LRISRIKGGMSNMLFL-CRL-----SEVYPPIR-N----EPNKVLLRVYFNPET-----ESHLVAESVIFTLLSE---------RHLG-PK--------LYGIF--------------S----------G--GRLEEYIPSR-PL------SCHEI----S-LAHMSTKIAKRVAKVHQLEVP--IW-KEPD---------------Y---------------L-----C---EA----LQRWLKQL------TGT---------VDAEHRFD------L-------------P----EECGVSSVNCL-------------DL---ARELEFLRA-------------HIS---LS--K--S--PVT----FCHNDLQEGNIL--LPK----------RLVLIDFEYASYNYRAFDFANHFIEW------------------TIDYDIDEAPFYKIQTENFP-------------------ENDQMLE-----------FFLNYLR--------EQG----N-------------TRENELYKKSEDL--V-QETLPFVPVSHFFWGVWGLLQVEL-S---PVGFGFADYGRDRLSLYFKHKQLLKNL------
43 HHSearch 73.9720% -25 - C1 - - 5FTG CHKA_HUMAN A:[30-378] -----------------------------------------------------------------D------E-FHISVIRGGLSNMLFQ-CSL-----PDTTATLG-D----EPRKVLLRLYG----------EAMVLESVMFAILAE---------RSLG-PK--------LYGIF--------------P----------Q--GRLEQFIPSR-RL------DTEEL----S-LPDISAEIAEKMATFHGMKMP--FN-K--EPK-------------W---------------L-----F---GT----MEKYLKEV------LRIKFTEESRIKK-------------L-------------HKLLSY-------NLP-------------LE---LEN---LRS-------------LLE---ST--P--S--PVV----FCHNDCQEGNIL--LLE--GRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW------------------M------------------YDYSYEKYPFFRANIRKYP-TKKQQLH-----------FISSYLP--------AFQ----NDFENLSTEEKSIIK---------EEM--L-LEVNRFALASHFLWGLWSIVQAKI-SS--I-EFGYMDYAQARFDAYFHQKRKLGV-------
52 HHSearch 73.9418% -54 - C1 - - 3MES ? B:[73-411] --------------------------------------------------------------------------IEVKQIFSGLTNQLFV-VSI-----VNE------L----KHPRILFRIYGKHV------FYDSKVELDVFRYLSN---------INIA-PN--------IIADF--------------P----------E--GRIEEFIDGE-PL------TTKQL----Q-LTHICVEVAKNMGSLHIINSK--RA-D--FPSRF-----------DKEPI-----------L-----F---KR----IYLWREEA------KIQVSKNN----QI------------DKEL----------Y----S-------KIL-------------EE---IDQLEELIMGGEKFSMERALELKLY---SP--A--F--SLV----FAHNDLQENNLL--QTQ---------NNIRMIDYEYSAINFAGADIANYFCEY------------------I------------------YDYCSEKQPYFKFKYEDYP-CEELRKL-----------FISVYLS--------QTL----Q-------------EQVMPSQQIVHIM--T-KAVEVFTLISHITWGLWSIA-----S---V-EFDFTEYANTRFTHYLQKKKELID-------
38 HHSearch 73.2816% -23 - C1 - - 1NW1 - CKA2_CAEEL B:[74-425] -----------------------------------------------------------------E------H-LRISRIKGGMSNMLFL-CRL-----SEVYPPIR-N----EPNKVLLRVYFNPET-----ESHLVAESVIFTLLSE---------RHLG-PK--------LYGIF--------------S----------G--GRLEEYIPSR-PL------SCHEI----S-LAHMSTKIAKRVAKVHQLEVP--IW-KEPD---------------Y---------------L-----C---EA----LQRWLKQL------TGT---------VDAEHRFD------L-------------P----EECGVSSVNCL-------------DL---ARELEFLRA-------------HIS---LS--K--S--PVT----FCHNDLQEGNIL--LPK----------RLVLIDFEYASYNYRAFDFANHFIEW------------------TIDYDIDEAPFYKIQTENFP-------------------ENDQMLE-----------FFLNYLR--------EQG----N-------------TRENELYKKSEDL--V-QETLPFVPVSHFFWGVWGLLQVEL-S---PVGFGFADYGRDRLSLYFKHKQLLKNL------
51 HHSearch 72.6118% -47 - C1 - - 3MES ? A:[73-411] --------------------------------------------------------------------------IEVKQIFSGLTNQLFV-VSI-----VNE------L----KHPRILFRIYGKHV--K---FYDSKVELDVFRYLSN---------INIA-PN--------IIADF--------------P----------E--GRIEEFIDGE-PL------TTKQL----Q-LTHICVEVAKNMGSLHIINSK--RA-D--FPSRF-----------DKEPI-----------L-----F---KR----IYLWREEA------KIQVSKNN-----I------------DKEL----------Y----S-------KIL-------------EE---IDQLEELIMGGEKFSMERALELKLY---SP--A--F--SLV----FAHNDLQENNLL--QTQ---------NNIRMIDYEYSAINFAGADIANYFCEY------------------I------------------YDYCSEKQPYFKFKYEDYP-CEELRKL-----------FISVYLS--------QTL----Q-------------EQVMPSQQIVHIM--T-KAVEVFTLISHITWGLWSIA---------V-EFDFTEYANTRFTHYLQKKKELID-------
59 SP3 71.7015% -10 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] ---------------------GMKELLSTMDLDTDANTIPELKERAHMLCARFLGGAWKTVPL--E------H-LRISRIKGGMSNMLFL-CRL-----SEVYPPIR-N----EPNKVLLRVYFNPET-----ESHLVAESVIFTLLSE---------RHLG-PK--------LYGIF--------------S----------G--GRLEEYIPSR-PL------SCHEI----S-LAHMSTKIAKRVAKVHQLEVP--IW-K--E---------------PDY-------------L-----C---EA----LQRWLKQL------TGT---------V-------------DAEHRFDLPEECGVS----S-------VNC-------------LD---LARELEFLR-------------AH----ISLSK--S--PVT----FCHNDLQEGNIL--LPK--R------LV--LIDFEYASYNYRAFDFANHFIEWTIDYDIDEAPFYKIQTENF------------------P-------------------ENDQMLE-----------FFLNYLR--------EQG----N-------------TRENELYKKSEDL--V-QETLPFVPVSHFFWGVWGLLQVELSP---V-GFGFADYGRDRLSLYFKHKQLLKN-LA----
44 HHSearch 71.5020% -2 - C1 - - 5FUT CHKA_HUMAN A:[30-378] -----------------------------------------------------------------D------E-FHISVIRGGLSNMLFQ-CSL-----PDTTATLG-D----EPRKVLLRLYG------G--AEAMVLESVMFAILAE---------RSLG-PK--------LYGIF--------------P----------Q--GRLEQFIPSR-RL------DTEEL----S-LPDISAEIAEKMATFHGMKMP--FN-K--EPK-------------W---------------L-----F---GT----MEKYLKEV------LRIKFTEESRIKK-------------L-------------HKLLSY-------NLP-------------LE---LEN---LRS-------------LLE---ST--P--S--PVV----FCHNDCQEGNIL--LLE--GRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW------------------M------------------YDYSYEKYPFFRANIRKYP-TKKQQLH-----------FISSYLP--------AFQ----NDFENLSTEEKSIIK---------EEM--L-LEVNRFALASHFLWGLWSIVQAKI-SS--I-EFGYMDYAQARFDAYFHQKRKLGV-------
23 Fugue 70.1216% 3 - C1 - - 2QG7 - ? A:[50-458] YPITESNLRILEGEDRSEKAKELLKKYVSNVFENEKTLYIYCKYVMLHYGKDLVN------PN--E------V-DSLEFQIINGTNILIK-VKD-----MSK------Q------AKYLIRLYGPTDEII---NREREKKISCILYNK-----------NIA-KK--------IYVFF--------------T----------N--GRIEEFMDGY-AL------SREDI----K-NPKFQKLIAKNLKLLHDIKLN--EN-L--Y---------------KELQVTQKVPGTRPSFL-----W---NT----IWKYFHLL------NEE---------R-------------KKICSFDAKANIL-K----L-------IDF-------------DV---LRDSIVEVE-------------SL----CK--R--ENSPIV----LCHCDLLSSNIINTVGE--G------DSISFIDFEYSCPMERAYDIANHFNEY------------------A------------------GFNCDWDLTP----------SKEEEYH-----------FIMHYLG--------TDD----E-------------E---------LINQLI-REIQPFYICSHINWGLWSLLQGMH-S---F-D--------FINYGMTRLTASCLPIFRSKV-
47 HHSearch 67.2417% -26 - C1 - - 3C5I ? D:[34-360] -----------------------------------------------------------------D------N-LRVKQIL--LTNQLFE-VGL-----KEETANNYNS----IRTRVLFRIYGKHVD-E---LYNTISEFEVYKTMSK---------YKIA-PQ--------LLNTF--------------N----------G--GRIEEWLYGD-PL------RIDDL----K-NPTILIGIANVLGKFHTLSRK--RH-L--PEHWDRTP--------C---------------I-----F---KM----MEKWKNQL------FKYKNIE-----K-------------Y-------------N----C-------DIH-------------KYIKESDKFIKFMK-------------VYSKSDNL--A--N--TIV----FCHNDLQENNII--NTN--K-------CLRLIDFEYSGFNFLATDIANFFIET------------------S------------------IDYSVSSYPFFEIDKKKYI-SYENRKL-----------FITAYLS--------NYLDKVVP-------------TPKLI-----DEI--L-EAVEVQALGAHLLWGFWSIIRGYQ-TKSYN-EFDFFLYAEQRLKMYDDQKEYLI--------
41 HHSearch 67.2019% -8 - C1 - - 4R7B - ? A:[29-304] -------------------------------------------------ISSLLS----QE-E--E------V-LSVEQL-GGMTNQNYL-AKT-----T--------------NKQYIVKFFGKGTE-K---LINRQDEKYNLELLKD---------LGLDVKN--------YLFDI--------------EA---------G--IKVNEYIESAITL------DSTS-------IKTKFDKIAPILQTIHTSAKE--LR-GE-F---------------A---------------P-----F---EE----IKKYESLI------EEQ---------I-------------P-------------Y----A-------NYE-------------SV---RNAVFSLEK-------------RLA---DL--G--V--DRK----SCHIDLVPENFI--ESP--Q------GRLYLIDWEYSSMNDPMWDLAALFLES------------------E------------------F-------------------TSQEEET-----------FLSHYES--------DQT----------------------------PVS--H-EKIAIYKILQDTIWSLWTVYKEEQ-------GEDFGDYGVNRYQRAVKGLASYG--------
42 HHSearch 66.7619% -12 - C1 - - 4R78 ? A:[29-304] -------------------------------------------------ISSLLS----QE-E--E------V-LSVEQL-GGMTNQNYL-AKT-----T--------------NKQYIVKFFGKGTE-K---LINRQDEKYNLELLKD---------LGLDVKN--------YLFDI--------------EA---------G--IKVNEYIESAITL------DSTS-------IKTKFDKIAPILQTIHTSAKE--LR-GE-F---------------A---------------P-----F---EE----IKKYESLI------EEQ---------I-------------P-------------Y----A-------NYE-------------SV---RNAVFSLEK-------------RLA---DL--G--V--DRK----SCHIDLVPENFI--ESP--Q------GRLYLIDWEYSSMNDPMWDLAALFLES------------------E------------------F-------------------TSQEEET-----------FLSHYES--------DQT----------------------------PVS--H-EKIAIYKILQDTIWSLWTVYKEEQ-------GEDFGDYGVNRYQRAVKGLASYG--------
50 HHSearch 61.4216% -14 - C1 - - 3CSV ? A:[7-306] -----------------------------------------------DEIRDFLA----THGY--A------D-WNRTP--------RYQRLRS-----PT-------------GAKAVLMDWSPEE------GGDTQPFVDLAQYLRN---------LDISAPE--------IYAEE--------------HAR--------G--LLLIEDLGDA-LF------TEVINNDPAQ-EMPLYRAAVDLLIHLHDAQTP--EL-AR-L---------------D---------------PETL--S---EMTRLAFSEYRYAI------LGD---------A-------------A-------------E----D-------NRK-------------RF---EHRFAQILS-------------A-----QL--E--G--DMV----FVHRDFHAQNLL--WLP--EREGL--ARVGVIDFQDAKLGHRAYDLVSLLQDA------------------R------------------RDV-----------------PAQVEAQ-----------MIDHYIQ--------ATG----V-------------D---------ESH--FRSAYAVIAVQRNMRILGIFARLSQR-F---G-KRHYIEFVPRVWAHFERGLAH----------
53 HHSearch 60.0013% -16 - C1 - - 2PPQ - KHSE_AGRFC A:[10-289] -----------------------------------------------DELRNFLT----QYDV--GS-----L-TSYKGIAE---NSNFL-LHT-----T--------------KDPLILTLYEK--------KNDLPFFLGLMQHLAA---------KGLSCPL--------PLPRK--------------DGELLGELSGRP--AALISFLEGM-WL------RKP--------EAKHCREVGKALAAMHLASEG--FE-I--K---------------RPNAL-----------S-----V---DG----WKVLWDKS------EERAD-------E-------------V-------------EKGLRE-------EIR-------------PE---IDY---LAA-------------HW----PK--D--L--PAG----VIHADLFQDNVF--FLG--D------ELSGLIDFYFACNDLLAYDVSICLNAW------------------CFEKDGA------------Y-------------------NVTKGKA-----------LLEGYQS--------VRP----L-------------S---------EAE--L-EALPLLSRGSALRFFLTRLYDWLT-T---P-A------------------------------
54 HHSearch 58.3915% -16 - C1 - - 6EF6 ? A:[30-324] ------------------------------------------------IAQQALT----HYDV--S------DNASLRLL-NLSENATYL-VED-----G--------------EHQSILRVHRQDY-HQ---PHEIESELDWLAALRTD--------SDVTVPT--------VVPARDGRRVVTVDPADVPR----------H--VVHFEMVGGA-EP------DEES-----L-TLDDFQTLGRITASLHEHSQR--WT-R--P---------------AG--------------F-----GRFSWD----WEHCLGDTPRWGRWQDAE--------GVGAS---------E-------------T----A-------LLT-------------RA---QDLLHRKLE-------------EYG---SG--P--D--RYG----LIHADLRLANLL--VDS--STPQ---RTITVIDFDDCGFGWYFYDFGTAVSFI------------------E------------------HDPR----------------LGEWQES-----------WVAGYRS--------RRE----L-------------P---------AAD--E-AMLPSFVFLRRLLLLAWMGSHTHS--------------------------------------
46 HHSearch 56.4414% 4 - C1 - - 3DXQ - ? B:[4-286] -----------------------------------------------DEARAKLA----AIPMLAG------Y-TGPLERLGGLTNLVFR-A-----------------------GDLCLRIP------------NRANEAVAAREAAK---------AGVS-PE--------VLHVD--------------P----------ATGVMVTRYIAGAQTM------SPEKF----KTRPGSPARAGEAFRKLHGSGAV--FPFR--F---------------E---------------L-----F---AM----IDDYLKVL------STKNV-------T-------------L-------------P----A-------GYH-------------DV---VREAGGVRS-------------ALA---AH--P--L--PLA----ACHCDPLCENFL--DTG---------ERMWIVDWEYSGMNDPLWDLGDLSVEG------------------K------------------F-------------------NANQDEE-----------LMRAYFG--------GEA------------------R---------PAE--R-GRVVIYKAMCDLLWTLWGLIQLAN-D---NPVDDFRAYADGRFARCKALME-----------
24 Fugue 54.7412% -24 - C1 - - 3ATS Y3168_MYCTU A:[1-357] --------------------------------------------TLPAVISRWLS----SVLP--GGAAPEVT-VESGVDSTGMSSETII-LTA-----RWQ------QDGRSIQQKLVARVAPAAEDVPVFPTYRLDHQFEVIRLVGELTDVPVPRVRWIE-TTGDVLGTPFFLMDY--------------V----------E--GVVPPDVMPY-TFGDNWFADAPAE----R-QRQLQDATVAALATLHSIPNA--QN-T--F---------------S---------------FLTDTTL---HR----HFNWVRSW------YDFA--------V-------------E-------------G----I-------GRS-------------PL---LERTFEWLQ-------------SH----WP--D--D--AAAREPVLLWGDARVGNVL--YRD--F------QPVAVLDWEMVALGPRELDVAWMIFAH------------------R------------------V-------------------FQELAGLATLPGLPEVMREDDVRAT--------YQA----L-------------T---------GVE--L-GDLHWFYVYSGVMWACVFMRTGAR-R---V-HFGEIE--KPDDVESLFYHAGLMKHLLGEEH
45 HHSearch 54.5414% 0 - C- - - 3DXQ - ? A:[4-286] -----------------------------------------------DEARAKLA----AIPMLAG------Y-TGPLERLGGLTNLVFR-A-----------------------GDLCLRIPGK--------YINRANEAVAAREAAK---------AGVS-PE--------VLHVD--------------P----------ATGVMVTRYIAGAQTM------SPEKF----KTRPGSPARAGEAFRKLHGSGAV--FPFR--F---------------E---------------L-----F---AM----IDDYLKVL------S--NV-------T-------------L-------------P----A-------GYH-------------DV---VREAGGVRS-------------ALA---AH--P--L--PLA----ACHCDPLCENFL--DTG---------ERMWIVDWEYSGMNDPLWDLGDLSVEG------------------K------------------F-------------------NANQDEE-----------LMRAYFG--------GEA------------------R---------PAE--R-GRVVIYKAMCDLLWTLWGLIQLAN-D---NPVDDFRAYADGRFARCKALME-----------