@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A9KJ63_LACP7: (2019-01-26 )
MEDKKMLHILNNLYNINFKTMEFLREGGCISYRLSSENSSYFMKIISSAFMDTAKQSLSIISYLTQKGFPSPRIIHTKEGLPYVEIEELNKKTLIVLFEFIEGSEPNEGEDIETIGKLVGQLHNILKGYKEPLPVHGKEFFIDRYIKILEQKNYDQNKIDTFREYGDVLWENVKNLPHGFCHGDLHRGNLLKTTTKKYYLLDFDTSSYAFPMYDIMVMCNSTDYFNFNEIGYQKSKNTYETFLKGYTKYRSLSKDELNSFYDFIAIYHYQLQATIIEIYGLNCVDIEFLDNQLNWLMKWREQCKAR

Atome Classification :

(21 SA) ------------------------.........10....-----.--.--..20....---...---.---30..--..---------.-.-.-.-40--------.......---..50--.----..-.-.....60-.....-..-----.70.-......--..80--.........-90........100.-.--...------.----.110.......120...-----------.--....--130--.------.--.-.-.---.---.---140..---.----...-------.---------150---.---------------.-------------.------.---.---.-------.-----.----160------....----...-----------..170-------.--.-----.-----.-----.----------------...180.......190--..--.---....200...---....210..----.....220-------..-----.......----230--....--------..------------------...240......--.250...---------......260......-...270..-.....------------280..-----------..--...290--.---...---....300....-----------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ------------------------MEDKKMLHILNNLYN-----I--N--FKTMEFLR---EGG---C---ISYR--LS---------S-E-N-S-S---------YFMKIIS---SAF---M----DT-A-KQSLSII-SYLTQ-KG-----FP-S-PRIIHT--KEG---LPYVEIEEL-NKKTLIVLFEFIEG-S--EPN------E----GEDIETIGKLVGQ-LHN-----------I--LKGY--KEP--L------P--V-H-G---K---E---FFIDR---Y----IKI-------L---------EQ----K---------------N-------------Y------D---Q---N-------K-----I----D--------TFRE----YGD-----------VLW-E-------N--V-----K-----N-----L----------------PHGFCHGDLHRGNLLK--TT--T---KKYYLLDFDT---SSYAFPMYD----IMVMCN---------ST-----DYFNFNE----I----GYQK--------SK------------------NTYETFLKGYTK--YR--SLS---------KDELNSF--YDFIAI-YHYQLQAT-IIEIY------------GLNCV-----------DI--EFLDN---Q---LNW---LMKWREQCKAR-----------
121 HHSearch 71.7620% -27 - C1 - - 2Q83 COTI_BACSU A:[26-305] ---------------------------------VLQGWD-----V--Q--AEKIDVIQ---------A---LVWK--VH---------T-D-S-G-A---------VCLKRIH---RPE--------KK-A-LFSIFAQ-DYLAK-KG-----MN-V-PGILPN--KKG---SLYSKHG-----SFLFVVYDWIEG-R--PFELT----V----KQDLEFIMKGLAD-FHT-----------A--SVGY--QPP--NGV----P--I-F-TK--L---G---RWPNH---YTKR-CKQ-------M---------ET----W---------------K-------------LMAEAEKE---D---PFSQLYLQE-----IDGFIE--------DGLR----IKD-----------RLL-QSTYVPWTE--Q-----L-----K-----K----------------SPNLCHQDYGTGNTLL--GE--N---EQIWVIDLDT---VSFDLPIRD----LRKMII---------PL-----LDTT-------------GVW--------DD------------------ETFNVMLNAYES--RA--PLT---------EEQKQVM--FIDMLF---------------------------------------------------------------------------------------
105 Fugue 67.3118% 18 - C1 - - 3I1A ? A:[3-330] ---------------------KQPIQAQQLIELLKVHYG-----I--D--IHTAQFIQ---GGA---DTNAFAYQ--AD---------S-E-S-K-S---------YFIKLKY---G----------YH-D-EINLSII-RLLHD-SG-----IK-EIIFPIHT--LEA---KLFQQ-----LKHFKIIAYPFIHA-P--NGFTQNL--T----GKQWKQLGKVLRQ-IHE-----------TSVPISI--QQQ--L------R--K-E-I---Y---S---PKWRE---I----VRS-------F---------YN----QIEFDNSDDKLTAAFKS-------------F------F---N---Q-------N-----S----A--------AIHR----LVD-----------TSE-K-------L--S-----KKIQPDL-----D----------------KYVLCHSDIHAGNVLV--GN--E---ESIYIIDWDE---PMLAPKERD----LMFIGG---------GV-----G---------------NVWN--------KP------------------HEIQYFYEGYGE--IN--V-----------DKTILSY--YRHERI-VEDIAVYG-QDLLS------------RNQ-------------NN--QSRLE---S---FKY---FKEMFDPNNVVEIAFATE----
120 HHSearch 66.4617% 26 - C1 - - 6EF6 ? A:[31-317] ------------------------------AQQALTHYD-----V--SD-NASLRLL----NLSE--N---ATYL--VE---------D-G-E-H-Q---------SILRVHR---QDYHQ-P----HE-I-ESELDWL-AALRTDSD-----VT-V-PTVVPA--RDG---RRVVTVDPAD-VPRHVVHFEMVGG-A--EPDEESL--T----LDDFQTLGRITAS-LHE-----------H--SQRW--TRP--AGFGR--F--S-W-D---W---E---HCLG----D----TPR-------W---------GR----W---------------Q-------------D------AEGVG---AS------E-----T----A--------LLTR----AQD-----------LLH-RKLE----E--YGS---G-----P-----D----------------RYGLIHADLRLANLLV--DS--STPQRTITVIDFDD---CGFGWYFYD----FGTAVS---------FI-----EHD---------------PR--------LG------------------EWQESWVAGYRS--RR--ELP---------AADEAML--PSFVFL-RRLLLLAW------------------------------------------------------------------------------
111 Fugue 63.9816% 17 - C1 - - 4OCV ? A:[24-378] -------------------------TNEALFDVASH-FA-----L--E--GTVDSIEP---YGDGHIN---TTYL--VT---------T-D-G-P-R---------YILQRMN---TGI---FPDTVNL-M-RNVELVT-STLKA-QG-----KE-T-LDIVRT--TSG---DTWAEIDG-----GAWRVYKFIEH-T--MSY------NLVPNPDVFREAGRAFGD-FQN-----------F--LSGF--DAN--QLTETIAH--F-H-D---T---P---HRFED---F----KKA-------L---------AA----D---------------E-------------L------G---R---A-------AGCGPEI----E--------FYLS----HADQYA--------VVM-D-------G--L-----R-----DGS---I----------------PLRVTHNDTKLNNILMDATT--G---KARAIIDLDTIMPGSMLFDFGD----SIRFGA---------STALE--DERDLDK----V----HF----------ST------------------ELFRAYTEGFVG--ELRDSIT---------AREAELL--PFSGNL-LTMECGMR-FLADYLEGDVYFATKYPEHNLV-----------RS--RTQIK---L---VRE---MEQRADETRAIVADVMETT---
2 PsiBlast_PDB 62.7722% -78 - C1 - - 3I0Q ? A:[6-251] ------------------------IQAQQLIELLKVHYG-----I--D--IHTAQFIQ---------A---FAYQ--AD---------S-E-S-K-S---------YFIKL-K---YGY---H----DE-I---NLSII-RLLHD-SGIKEIIFP------IHT--LEA---KLFQQLKHF-K----IIAYPFIHA-----PNGFTQNLT----GKQWKQLGKVLRQ-IHE-----------T--------SVP--I------S--I-Q-QQLRK---E---IYSPK---W----REIVRSFYNQI---------EF----D---------------N-------------S------D---D---K-------L-----T----A--------AFKS----FFN-----------QNS-A-------A--I-----H-----R-----LVDTSEKLSKKIQPDLDKYVLCHSDIHAGNVLV--GN--E---ESIYIIDWDE---PMLAPKERD----LMFI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
102 Fugue 59.2714% 12 - C1 - - 2PPQ - KHSE_AGRFC A:[5-320] ----------------------TDITEDELRNFLTQ-YD-----V--G---SLTSYKG---IAE---N---SNFL--LH---------T-T-K-D-P---------LILTLYE---K----------KN-D-LPFFLGLMQHLAA-KG-----LS-C-PLPLPR--KDG---ELLGEL-----SGRPAALISFLEGMW--LRKP-----E----AKHCREVGKALAAMHLA-----------S--EGFE--IKR--P------N--A-L-S---V---D---GWKVL---W----DKS-------E---------ER----A---------------D-------------E------V---E---KGL-----R-----E----E--------IRPE----IDY-----------LAA-H-------W--P-----K-----D-----L----------------PAGVIHADLFQDNVFF--LG--D---ELSGLIDFYF---ACNDLLAYD----VSICLN---------AW-----CFEKDGA----Y----------------NV------------------TKGKALLEGYQS--VR--PLS---------EAELEAL--PLLSRG-SALRFFLT-RLYDW------------LTTPA-----------GA--LVVKKDPLE---YLR---KLRFHRTIANVAEYGLA-----
119 HHSearch 58.8719% -10 - C1 - - 2PPQ - KHSE_AGRFC A:[8-272] -------------------------TEDELRN-FLTQYD-----V--GS-LTSYKGIA---E-----N---SNFL--LH---------T-T-K-D-P---------LILTLYE---K-----K----ND-L-PFFLGLM-QHLAA-KG-----LS-C-PLPLPR--KDG---ELLGELS-----GRPAALISFLEG-M--WLRKP----E----AKHCREVGKALAA-MHL-----------A--SEGF--EIK--R------P--N-A-L---S---V---DGWKV---L----WDK-------S---------EE----R---------------A-------------D------E---VE--KG------L-----R----E--------EIRP----EID-----------YLA-A-------H--WP----K-----D-----L----------------PAGVIHADLFQDNVFF--LG--D---ELSGLIDFYF---ACNDLLAYD----VSICLN---------AW-----CFEK------------DGAY--------NV------------------TKGKALLEGYQS--VR--PLS---------EAELEAL--PLLSRG-S-------------------------------------------------------------------------------------
1 PsiBlast_PDB 57.4422% -0 - C1 - - 3I0O ? A:[6-246] ------------------------IQAQQLIELLKVHYG-----I--D--IHTAQFIQ---GGADTNA---FAYQ--AD---------S-E-S-K-S---------YFIKL-K---YGY---H----DE-I---NLSII-RLLHD-SGIKEIIFP------IHT--LEA---KLFQQLKHF-K----IIAYPFIHA-----PNGFTQNLT----GKQWKQLGKVLRQ-IHE-----------T--------SVP--I------S--I-Q-QQLRK---E---IYSPK---W----REIVRSFYNQI---------EF----D---------------N-------------S------D---D---K-------L-----T----A--------AFKS----FFN-----------QNS-A-------A--I-----H-----R-----LVDTSEKLSKKIQPDLDKYVLCHSDIHAGNVLV--GN--E---ESIYIIDWDE---PMLAPKERD----LMFI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
123 HHSearch 57.2015% 14 - C1 - - 4OCV ? A:[24-318] -------------------------TNEALFD-VASHFA-----L--EGTVDSIEPYG---DGHI--N---TTYL--VT---------T-D-G-P-R---------YILQRMN---TGIFPDT----VN-LMRNVELVT-STLKA-QG-----KE-T-LDIVRT--TSG---DTWAEID-----GGAWRVYKFIEH-T--MSYNLVP--N----PDVFREAGRAFGD-FQN-----------F--LSGF--DAN--Q------LTETIA-H---FHDTP---HRFED---F----KKA-------L---------AA----DELGR-----------A-------------A------G---C---GP------E-----I----E--------FYLS----HAD-----------QYA-VVMD----G--LRD---G-----S-----I----------------PLRVTHNDTKLNNILM--DATTG---KARAIIDLDT---IMPGSMLFD----FGDSIR---------FG-----ASTALEDERDLD----KVHF--------ST------------------ELFRAYTEGFVGELRD--SIT---------AREAELL--PFSGNL---------------------------------------------------------------------------------------
125 HHSearch 57.1821% 4 - C1 - - 3I1A ? B:[7-272] -------------------------QAQQLIELLKVHYG-----I--D--IHTAQFIQ---GGAD--T---NAFAYQAD---------S-E-S-K-S---------YFIKLKY---GYH-----------D-EINLSII-RLLHD-SG-----IKEI-IFPIHT--LEA---KLFQQLK-----HFKIIAYPFIHA-P--NGFTQNL--T----GKQWKQLGKVLRQ-IHE-----------T--SVPI--SIQ--Q------QLRK-E-I---Y---S---PKWRE---IVRSFYNQ-------I---------EF----DNSDDKLTAA------FKSFF---------N------Q---N---SA------A-----I----H--------RLVD----TSE-----------KLS-K-------K--IQP---D-----L-----D----------------KYVLCHSDIHAGNVLV--GN--E---ESIYIIDWDE---PMLAPKERD----LMFIGG---------GV-----GNVW---------------N--------KP------------------HEIQYFYEGYGE--IN--V-----------------------------------------------------------------------------------------------------------------
94 SP3 56.9912% -22 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] -----GMKELLSTMDLDTDANTIPELKERAHMLCARFLGGAWKTV--P--LEHLRISRIKGGMS---N---MLFL--CR---------L-S-E-V-YPPIRNEPNKVLLRVYFN--PET---E----SH-L-VAESVIF-TLLSE-RH-----L--G-PKLYGI--FSG------------------GRLEEYIPS-R--PLSCHEIS-L----AHMSTKIAKRVAK-VHQ-----------L--EVPI--WKE--P------DYLC-E-A---L---Q---RWLKQ---L----TGT-------VDAEHRFDLPEE----C---------------G-------------V------S---S---V-------N-----C----L--------DLAR----ELE-----------FLR-A-------H--I-----S-----L-----SKS--------------PVTFCHNDLQEGNILL--PK--R-----LVLIDFEY---ASYNYRAFD----FANHFI---------EW-----TIDYDID----E----APFYKIQTENFPEN------------------DQMLEFFLNYLR--EQ--GNTRENELYKKSEDLVQETLPFVPVSH-FFWGVWGL-LQV--------------ELSPV-----------GF--GFADY---GRDRLSL---YFKHKQLLKNLA----------
5 PsiBlast_PDB 56.7424% 28 - C1 - - 2Q83 COTI_BACSU A:[79-346] ---------------------------------------------------------------------------------------------------------------------------------------------YLAK-KG-----MN-V-PGILPN--KKG---SLYSK-----HGSFLFVVYDWIEG-RPFELT------V----KQDLEFIMKGLAD-FHT-----------A--SVGY--QPPNGV------P--I-F-T---KL--G---RWPNH---Y----TKR-------C---------KQ----M---------------ETWKLMAEAEKEDPF------S---QLYLQ-------E-----I----D--------GFIE----DGLRIKDRLLQSTYVPWTE-------Q--L-----K-----K-----S----------------PN-LCHQDYGTGNTLL--GE--N---EQIWVIDLDT---VSFDLPIRDLRKMIIPLLD---------TTGVWDDETFNVML----N----AYES--------RAPLTEEQKQVMFIDMLFPYELYDVIREKYVR--KS--ALP---------KEELESA--FEYERI-KANALRQL-I----------------------------------------------------------------------------
4 PsiBlast_PDB 56.6722% -9 * C1 * - 3Q2M ? A:[6-246] ------------------------IQAQQLIELLKVHYG-----I--D--IHTAQFIQ---GGADTNA---FAYQ--AD---------S-E-S-K-S---------YFIKL-K---YGY---H----DE-I---NLSII-RLLHD-SGIKEIIFP------IHT--LEA---KLFQQLKHF-K----IIAYPFIHA-----PNGFTQNLT----GKQWKQLGKVLRQ-IHE-----------T--------SVP--I------S--I-Q-QQLRK---E---IYSPK---W----REIVRSFYNQI---------EF----D---------------N-------------S------D---D---K-------L-----T----A--------AFKS----FFN-----------QNS-A-------A--I-----H-----R-----LVDTSEKLSKKIQPDLDKYVLCHSDIHAGNVLV--GN--E---ESIYIIDWDE---PMLAPKERD----LMFI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
122 HHSearch 55.8816% 2 - C1 - - 1ZYL - SRKA_ECOLI A:[12-280] -------------------------HPDTIMD-ALFEHG-----I--RV-DSGLTPL----NSYE--N---RVYQ--FQ---------D-EDR-R-R---------FVVKFYR---PERWT-A----DQ-I-LEEHQFA-LQLVN-DE-----VP-V-AAPVA---FNG---QTLLNHQ-----GFYFAVFPSVGG-R--QFEAD----N----IDQMEAVGRYLGR-MHQ-----------T--GRKQ--LFI--HR-----P--T-I-G---L---N---EYLIE---P----RKL-------F---------ED----A---------------T-------------L------I---P---SG------L-----K----A--------AFLK----ATD-----------ELI-A-------A--VTAHWRE-----D-----F----------------TVLRLHGDCHAGNILW--RD-------GPMFVDLDD---ARNGPAVQD----LWMLLN---------GD-----KA-----------------E--------QR------------------MQLETIIEAYEE--FS--EFD---------TAEIGLI--EPLRAM-RLVYYLAW------------------------------------------------------------------------------
3 PsiBlast_PDB 55.4422% 2 - C1 - - 3I1A ? A:[6-246] ------------------------IQAQQLIELLKVHYG-----I--D--IHTAQFIQ---GGADTNA---FAYQ--AD---------S-E-S-K-S---------YFIKL-K---YGY---H----DE-I---NLSII-RLLHD-SGIKEIIFP------IHT--LEA---KLFQQLKHF-K----IIAYPFIHA-----PNGFTQNLT----GKQWKQLGKVLRQ-IHE-----------T--------SVP--I------S--I-Q-QQLRK---E---IYSPK---W----REIVRSFYNQI---------EF----D---------------N-------------S------D---D---K-------L-----T----A--------AFKS----FFN-----------QNS-A-------A--I-----H-----R-----LVDTSEKLSKKIQPDLDKYVLCHSDIHAGNVLV--GN--E---ESIYIIDWDE---PMLAPKERD----LMFI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
124 HHSearch 55.2214% 6 - C1 - - 4WH3 NAHK_BIFL2 A:[5-298] --------------------------NEVLFG-IASHFA-----LEGA--VTGIEPYG---DGHI--N---TTYL--VT---------T-D-G-P-R---------YILQQMN---TSIFPDT----VNLM-RNVELVT-STLKA-QG-----KE-T-LDIVPT--TSG---ATWAEID-----GGAWRVYKFIEH-T--VSYNLVP--N----PDVFREAGSAFGD-FQN-----------F--LSEF--DAS--QLT----E--T-IAH---F---HDTPHRFED---F----KAA-------L---------AADKLGR---------------A-------------A------A---C---QP------E-----I----D--------FYLS----HAD-----------QYA-V-------V--MDGLRDG-----S-----I----------------PLRVTHNDTKLNNILM--DATTG---KARAIIDLDT---IMPGSMLFD----FGDSIR---------FG-----ASTALED----EKDLSKVHF--------ST------------------ELFRAYTEGFVGELRG--SIT---------AREAELL--PFSGNL---------------------------------------------------------------------------------------
104 Fugue 53.7114% 30 - C1 - - 1ZYL - SRKA_ECOLI A:[4-328] -----------------SAFTFQTLHPDTIMDALFEHGI-----R--V--DSGLTPLN---SYE---N---RVYQ--FQ---------D-E-DRR-R---------FVVKFYR---PERWT-A----DQ-I-LEEHQFA-LQLVN-DE-----VP-V-AAPVAF--NGQ---TLLNH------QGFYFAVFPSVGG-R--QFE------ADN--IDQMEAVGRYLGR-MHQ-----------T--GRKQLFIHR--P------T--I-G-L---N---E---YLIEP---R----KLF-------E---------DA----T---------------L-------------I------P---S---G-------L-----K----A--------AFLK----ATD-----------ELI-A-------A--V-----T-----AHWREDF----------------TVLRLHGDCHAGNILW--R-------DGPMFVDLDD---ARNGPAVQD----LWMLLN---------GD----------------------KAE--------QR------------------MQLETIIEAYEE--FS--EFD---------TAEIGLI--EPLRAM-RLVYYLAW-LMRRW------------ADPAF-----------PKNFPWLTG---E---DYWLRQTATFIEQAKVLQEPPLQLTPMY
118 HHSearch 52.3015% 5 - C1 - - 4PDY ? A:[27-317] ---------------------------------VVSKYD-----L--A--IQQR--------HA---D---GNIE--VW---------TDS-K-GRR---------YAAKRSS---IA----P----AH-C-RIMVQCL-RHAQE-QG-----FTKF-ARFVTT--SSN---APYVRHG-----DFTYYVTEWVSG-Q--PANFG----L----PEHVAQTAYTLAQ-FHE-----------A--TRSF--RTD--WK--------------------D---DVFGLFQAR----WRD-------L---------RQ----M---------------WLGA----------DRK----REK-D---AFDQLLLSM-----R----D--------ELHRDAAESLA-----------LFE-DRDVIA--YLEA-----E-----R-----S----------------SGGWCHLDVIPSNCLY--TP--Q---HQVVLIDFEL---ARPAPRALD----MAHLLR---------RS-----LERG--------------NW--------DG------------------HLAYACFLHFDA--VR--NIP---------KSEYRAV--EAILRFPYLPWRIAHARYHFA------------A-----------------------------------------------------------
93 SP3 51.2213% 4 - C1 - - 1J7L KKA3_ENTFL A:[2-264] -------------------------AKMRISPELKKLIE-----K--Y--RCVKDTEG---MSP---A---KVYK--LV---------G-E-N-E-N---------LYLKMTDSRYKGT---T----YD-V-EREKDMM-LWLE--GK-----LP-V-PKVLHFERHDG---WSNLLMSEA-DGVLCSEEYE-----D--EQS------P----EKIIELYAECIRL-FHS-----------I----DI--SDC--P------Y--T-N-S---L---D---SRLAE---L----DYL-------L---------NN----D---------------L-------------A------D---V---D-------C-----E----NWEEDTPFKDPRE----LYD-----------FLK-T-------E--K-----P-----E-----E----------------ELVFSHGDLGDSNIFV--KD--G---KVSGFIDLGR---SGRADKWYD----IAFCVR---------SI-----REDIGEE-----------------------------------------QYVELFFDLLG----I--KPD---------WEKIKYY--ILLDEL-F-------------------------------------------------------------------------------------
113 Fugue 50.0014% 18 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] GMKELLSTMDLDTDANTIPELKERAHMLCARFLGGAWKT-----V--P--LEHLRISR---IKGGMSN---MLFL--CRLSEVYPPIRN-E-P-N-K---------VLLRVYF---NPE---T----ES-H-LVAESVI-FTLLS-ER-----HL-G-PKLYGI--FSGGRLEEYIPSRPL-SCHEIS---------------------L----AHMSTKIAKRVAK-VHQLEVPIWKEPDYL--CEAL--QRW--L------K--Q-L-T---G---T---VDAEH---R----FDL-------P---------EE----C---------------G-------------V------S---S---V-------N-----C----L--------DLAR----ELE-----------FLR-A-------H--I-----S-----L-----SKS--------------PVTFCHNDLQEGNILL--P-------KRLVLIDFEY---ASYNYRAFD----FANHFIEWTIDYDIDEA-----PFYKIQT----E----NFPE--------ND------------------QMLEFFLNYLRE--QG--NTR---------ENELYKK--SEDLVQ-ETLPFVPV-SHFFW------------GVWGLLQVELSPVGFGFA--DYGRD---R---LSL---YFKHKQLLKNLA----------
131 HHSearch 44.0919% 7 - C1 - - 4R78 ? A:[39-258] --------------------------------------------------VLSVEQL----GGMT--N---QNYL--AK---------T-T-N-K-Q---------YIVKFFG---KGTEK-L----IN-R-QDEKYNL-ELLKD-LG-----LD-V-KNYLFD--I-----------------EAGIKVNEYIES-AI-TLDSTS---I----KTKFDKIAPILQT-IHT-----------S--AKEL--RGE--------------F-A---P---F---EEIKK---Y----ESL-------I---------EE----Q---------------I-------------P------Y---A-----------N-----Y----E--------SVRN----AVF-----------SLE-K-------R--LAD---L-----G-----V----------------DRKSCHIDLVPENFIE--SP--Q---GRLYLIDWEY---SSMNDPMWD----LAALFL---------ES-----E------------------F--------TS------------------QEEETFLSHYES--DQ--TPV---------SHE---------------------------------------------------------------------------------------------------