@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A9NGK0_ACHLI: (2019-01-26 )
MLIEDKIVEIATRVFQVNEIDVRVDSRFKGGMSNYTYLVYVKEQPYVIRIIGDGGEVLVKPSIEKKHIQQAKALNLNSELVYFDSKTGVKVSKYVEGTPLSVSMEETDYPLVANALKTLHQAKLPGEDYGLKERLRRYEKLLKKEPSTTYYTLKMQWLKLYDAYFSKLPKVLCHGDAQRSNLVKSGDKIYLLDWEFSGLNDPYYDIASFGNIDFKDAEKLLGYYLERTPSAFELAHIRFYRMYQVLQWHIVATYKHEINLSEKLHLDFEMIAGKYLSLAGHFLEQLKEIEQFK

Atome Classification :

(22 SA) -----------------------------------.........10.....--.-.--.---20....----....30........40.---------.----------.---------.---------....50.......--.60.---.....-----..70..-....-..80....------------.----...90......----.-.----------------100-.--.--.---.....110.......120--.--...--..----.------------.-----130-------------.....---....140...---------------.-------.------.---------------.150-----------.-----------..---......160-----------...----.--.-..--.170---------.......180.---...-------.-..190........200......-.-----------------210--------------------..-----------------.--------------------.....---220....---.----------..--------------230--------.........240.......250.......260.......270.......280.......290.-
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -----------------------------------MLIEDKIVEIATRVFQ--V-N--E---IDVRVD----SRFKGGMSNYTYLVYVK---------E----------Q---------P---------YVIRIIGDGGEVL--VKPS---IEKKH-----IQQAKA-LNLN-SELVYFDS------------K----TGVKVSKYVEG----T-P----------------LS--V--S--M---EETDYPLVANALKTLHQ---A--KLP--GE----D------------Y-----G---------------LKERL---RRYEKLLKKE---------------P-------S------T---------------TY-------------Y-----------TL---KMQWLKLY------------DAY----F--S-KL--PKVL---------CHGDAQRSNLV---KSG-------D-KIYL-LDWEFSGLNDPYYDIAS-F-----------------GN---------------------ID-----------------F--------------------KDAEK---LLGYYLE---R----------TP--------------S----------AFELAHIRFYRMYQVLQWHIVATYKHEINLSEKLHLDFEMIAGKYLSLAGHFLEQLKEIEQFK-
32 HHSearch 85.2825% 13 - C2 - - 4R7B - ? A:[24-304] ----------------------------------------IIKEKISSLLS--Q-E------EEVLSV----EQL-GGMTNQNYLAKTT---------N----------K---------Q---------YIVKFFGKGTEKL--INRQ---DEKYN-----LELLKD-LGLD-VKNYLFDI------------E----AGIKVNEYIES----AIT----------------LD--S--T--S---IKTKFDKIAPILQTIHT---S--AKE--LRG---E------------F-----A---------------PFEEI---KKYESLIEEQ---------------I-------PY-----A---------------NY-------------E-----------SV---RNAVFSLE-------------KR----LADL-GV--DRKS---------CHIDLVPENFI---ESP-------QGRLYL-IDWEYSSMNDPMWDLAA-L-----------------FLE--------------------SE-----------------FTS------------------QEEET---FLSHYES---D----------QT-------------------------PVSHEKIAIYKILQDTIWSLWTVYKEEQGE------DFGDYGVNRYQRAVKGLASYG-------
31 HHSearch 85.0525% 19 * C2 * - 4R78 ? A:[24-304] ----------------------------------------IIKEKISSLLS--Q-E------EEVLSV----EQL-GGMTNQNYLAKTT---------N----------K---------Q---------YIVKFFGKGTEKL--INRQ---DEKYN-----LELLKD-LGLD-VKNYLFDI------------E----AGIKVNEYIES----AIT----------------LD--S--T--S---IKTKFDKIAPILQTIHT---S--AKE--LRG---E------------F-----A---------------PFEEI---KKYESLIEEQ---------------I-------PY-----A---------------NY-------------E-----------SV---RNAVFSLE-------------KR----LADL-GV--DRKS---------CHIDLVPENFI---ESP-------QGRLYL-IDWEYSSMNDPMWDLAA-L-----------------FLE--------------------SE-----------------FTS------------------QEEET---FLSHYES---D----------QT-------------------------PVSHEKIAIYKILQDTIWSLWTVYKEEQGE------DFGDYGVNRYQRAVKGLASYG-------
37 HHSearch 75.9221% -14 - C2 - - 3DXQ - ? B:[6-288] -----------------------------------------ARAKLAAIPM--L-A--G-----YTGP----LERLGGLTNLVFRA-----------------------G---------D---------LCLRIP----------NRA---NEAVA-----AREAAK-AGVS-PEVLHVDP------------A----TGVMVTRYIAG----AQT----------------MS--P--E--KFKTRPGSPARAGEAFRKLHG---S--GAV--FPF---R------------F-----E---------------LFAMI---DDYLKVLSTK---------------N-------V------TLPA------------GY-------------H-----------DV---VREAGGVR-------------SA----LAAH-PL--PLAA---------CHCDPLCENFL---DTG-------E-RMWI-VDWEYSGMNDPLWDLGD-L-----------------SVE--------------------GK-----------------FNA------------------NQDEE---LMRAYFG---G----------EA--------------R----------PAERGRVVIYKAMCDLLWTLWGLIQLANDN---PVDDFRAYADGRFARCKALMETP--------
38 HHSearch 75.0321% -10 - C- - - 3DXQ - ? A:[6-288] -----------------------------------------ARAKLAAIPM--L-A--G-----YTGP----LERLGGLTNLVFRA-----------------------G---------D---------LCLRIPGK----Y--INRA---NEAVA-----AREAAK-AGVS-PEVLHVDP------------A----TGVMVTRYIAG----AQT----------------MS--P--E--KFKTRPGSPARAGEAFRKLHG---S--GAV--FPF---R------------F-----E---------------LFAMI---DDYLKVLS-----------------N-------V------TLPA------------GY-------------H-----------DV---VREAGGVR-------------SA----LAAH-PL--PLAA---------CHCDPLCENFL---DTG-------E-RMWI-VDWEYSGMNDPLWDLGD-L-----------------SVE--------------------GK-----------------FNA------------------NQDEE---LMRAYFG---G----------EA--------------R----------PAERGRVVIYKAMCDLLWTLWGLIQLANDN---PVDDFRAYADGRFARCKALMETP--------
54 Fugue 73.0419% 8 - C2 - - 1NW1 - CKA2_CAEEL A:[32-426] -----------------GMKELLSTMDLDTDANTIPELKERAHMLCARFLG--G-A--W---KTVPLEHLRISRIKGGMSNMLFLCRLS---------E----------V---------YPPIRNEPNKVLLRVYFNPET-----ESH---LVAES-----VIFTLL-SERH-LGPKLYGI------------F----SGGRLEEYIPS----R-P----------------LSCHE--I--S---LAHMSTKIAKRVAKVHQ---L--EVPIWKE----P------------D-----Y---------------LCEAL---QRWLKQLTGTVDAEHRFDLPEECGVS-------S------V---------------NC-------------L-----------DL---ARELEFLR------------AHI----S--LSKS--PVTF---------CHNDLQEGNIL---LP--------K-RLVL-IDFEYASYNYRAFDFAN-H-----------------FIEWTIDYDIDEAPFYKIQTENFPE-----------------N--------------------DQMLE---FFLNYLR---EQGNTRENELYKK--------------S----------EDLVQETLPFVPVSHFFWGVWGLLQVELSPVG---FGFADYGRDRLSLYFKHKQLLKNLA----
33 HHSearch 73.0320% -19 - C2 - - 1NW1 - CKA2_CAEEL B:[56-425] -----------------------------------------AHMLCARFLG--GAW--KTVPLEHLRI----SRIKGGMSNMLFLCRLSEVYPPIRNEP----------N---------K---------VLLRVYFNPET-E--SHLV---AESVI-----FTLLSE-RHLG-PKLYGIF------------------SGGRLEEYIPS----R-P----------------LS--C--H--EIS-LAHMSTKIAKRVAKVHQ---L--EVP--IWKE--P------------D-----Y---------------LCEAL---QRWLKQLTGT---------------V-------D------AEHRF-----------DL-------------PEECGVSSVNCLDL---ARELEFLR-------------AH----ISLS-KS--PVTF---------CHNDLQEGNIL---LPK---------RLVL-IDFEYASYNYRAFDFAN-H-----------------FIE--------------------WT-----------------IDYDIDEAPFYKIQTENFPENDQMLE---FFLNYLR---E----------QG--------------NTRENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSP---VGFGFADYGRDRLSLYFKHKQLLKNL-----
2 PsiBlast_PDB 72.6230% 25 - C2 - - 4R78 ? A:[46-280] ----------------------------------------------------------------------------GGMTNQNYLAKTT---------N----------K---------Q---------YIVKFFGKGTEKL--INRQ---DEKYN-----LELLKD-LGLD-VKNYLFDI------------E----AGIKVNEYIES----AIT----------------LD--S--T--S---IKTKFDKIAPILQTIHT---SAKELR--GE-----------------F-----A---------------PFEEI---KKYESLIEEQI--------------P-------Y------A---------------NY-------------E-----------SV---R-------------------NAV----F--S--L--EKRLADLGVDRKSCHIDLVPENFI---ESP-------QGRLYL-IDWEYSSMNDPMWDLAALF-----------------LE---------------------SE-----------------F--------------------TSQEEETFLSHYESD---Q----------TP--------------V----------SHE--KIAIYKILQDTIWSLWTVYKEE-------------------------------------
69 SP3 72.4618% -8 - C2 - - 1NW1 - CKA2_CAEEL A:[32-426] -------------GMKELLSTMDLDTDANTIPELKERAHMLCARFLGGAWK--T-V--P---LEHLRI----SRIKGGMSNMLFLCRLS---------E----------VYPPIRNEPNK---------VLLRVYF-NPETE--SHLV---AESVI-----FTLLSE-RHLG-PKLYGIF------------------SGGRLEEYIPS----R-P----------------LS--CHEI--S---LAHMSTKIAKRVAKVHQ---L--EVP--IW----K------------E-----PDY-------------LCEAL---QRWLKQLTGT---------------V-------D------AEHRFDLPEECGVSSVNC-------------L-----------DL---ARELEFLR------------AHI----S--LSKS--PVTF---------CHNDLQEGNIL---LP--------K-RLVL-IDFEYASYNYRAFDFAN-H-----------------FIEWTIDYDIDEAPFYKIQTENFPE-----------------N--------------------DQMLE---FFLNYLR---E----------QG--------------NTRENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSP---VGFGFADYGRDRLSLYFKHKQLLKNLA----
3 PsiBlast_PDB 71.9830% 23 - C2 - - 4R7B - ? A:[46-280] ----------------------------------------------------------------------------GGMTNQNYLAKTT---------N----------K---------Q---------YIVKFFGKGTEKL--INRQ---DEKYN-----LELLKD-LGLD-VKNYLFDI------------E----AGIKVNEYIES----AIT----------------LD--S--T--S---IKTKFDKIAPILQTIHT---SAKELR--GE-----------------F-----A---------------PFEEI---KKYESLIEEQI--------------P-------Y------A---------------NY-------------E-----------SV---R-------------------NAV----F--S--L--EKRLADLGVDRKSCHIDLVPENFI---ESP-------QGRLYL-IDWEYSSMNDPMWDLAALF-----------------LE---------------------SE-----------------F--------------------TSQEEETFLSHYESD---Q----------TP--------------V----------SHE--KIAIYKILQDTIWSLWTVYKEE-------------------------------------
34 HHSearch 71.9620% -14 - C2 - - 1NW1 - CKA2_CAEEL A:[56-425] -----------------------------------------AHMLCARFLG--GAW--KTVPLEHLRI----SRIKGGMSNMLFLCRLSEVYPPIRNEP----------N---------K---------VLLRVYFNPET-E--SHLV---AESVI-----FTLLSE-RHLG-PKLYGIF------------------SGGRLEEYIPS----R-P----------------LS--C--H--EIS-LAHMSTKIAKRVAKVHQ---L--EVP--IWKE--P------------D-----Y---------------LCEAL---QRWLKQLTGT---------------V-------D------AEHRF-----------DL-------------PEECGVSSVNCLDL---ARELEFLR-------------AH----ISLS-KS--PVTF---------CHNDLQEGNIL---LPK---------RLVL-IDFEYASYNYRAFDFAN-H-----------------FIE--------------------WT-----------------IDYDIDEAPFYKIQTENFPENDQMLE---FFLNYLR---E----------QG--------------NTRENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSP---VGFGFADYGRDRLSLYFKHKQLLKNL-----
35 HHSearch 71.4122% 16 - C2 - - 2QG7 - ? E:[109-453] ---------------------------------------------------------------DSLEF----QIING-ITNILIKVKDMSK-------Q----------A---------K---------YLIRLYGPKTDEI--INRE---REKKI-----SCILYN-KNIA-KKIYVFFT------------------NGRIEEFMDG----Y-A----------------LS--R--E--DIK-NPKFQKLIAKNLKLLHD---I--KLN--ENLYK-ELQVTQKVPGTRPS-----F---------------LWNTI---WKYFHLLNEE---------------R-------K------KICSFDAKANILKLI-DF-------------D-----------VL---RDSIVEVE-------------SL----CKRE-NS--PIVL---------CHCDLLSSNII---NTVGG-----D-SISF-IDFEYSCPMERAYDIAN-H-----------------FNE--------------------YAGFNCD------------WDLTPSK--------------EEEYH---FIMHYLG---T----------DD--------------EELI-------NQLIREIQPFYICSHINWGLWSLLQGMHSS----DFDFINYGMTRLTASCLPI-----------
1 PsiBlast_PDB 70.7430% 24 - C2 - - 4R77 - ? B:[26-260] ----------------------------------------------------------------------------GGMTNQNYLAKTT---------N----------K---------Q---------YIVKFFGKGTEKL--INRQ---DEKYN-----LELLKD-LGLD-VKNYLFDI------------E----AGIKVNEYIES----AIT----------------LD--S--T--S---IKTKFDKIAPILQTIHT---SAKELR--GE-----------------F-----A---------------PFEEI---KKYESLIEEQI--------------P-------Y------A---------------NY-------------E-----------SV---R-------------------NAV----F--S--L--EKRLADLGVDRKSCHIDLVPENFI---ESP-------QGRLYL-IDWEYSSMNDPMWDLAALF-----------------LE---------------------SE-----------------F--------------------TSQEEETFLSHYESD---Q----------TP--------------V----------SHE--KIAIYKILQDTIWSLWTVYKEE-------------------------------------
55 Fugue 70.3220% 17 - C2 - - 2QG7 - ? A:[50-458] YPITESNLRILEGEDRSEKAKELLKKYVSNVFENEKTLYIYCKYVMLHYGKDLV-N--P---NEVDSL----EFQIINGTNILIKVKDM---------SKQ--------A---------K---------YLIRLYGPT-DEI--INRE---REKKI-----SCILYN-KNIA-KKIYVFFT------------------NGRIEEFMDG----Y-A----------------LS--R--EDIK---NPKFQKLIAKNLKLLHD---I--KLN--EN----L------------Y-----KELQVTQKVPGTRPSFLWNTI---WKYFHLLNEE---------------R-------K------K---------------ICSFDAKANILKLIDF-----------DV---LRDSIVEV------------ESL----C--K-RENSPIVL---------CHCDLLSSNIINTVGEG-------D-SISF-IDFEYSCPMERAYDIAN-HFNEYAGFNCDWD-----LT---------------------PS-----------------K--------------------EEEYH---FIMHYLGTDDE----------EL--------------I----------NQLIREIQPFYICSHINWGLWSLLQGMHSF------DFINYGMTRLTASCLPIFRSKV------
36 HHSearch 68.1222% 17 - C2 - - 2QG7 - ? D:[109-453] ---------------------------------------------------------------DSLEF----QIINGG-TNILIKVKDMSK-------Q----------A---------K---------YLIRLYGPKTD-----NRE---REKKI-----SCILYN-KNIA-KKIYVFFT------------------NGRIEEFMDG----Y-A----------------LS--R--E--DIK-NPKFQKLIAKNLKLLHD---I--KLN--ENLYK-ELQVTQKVPGTRPS-----F---------------LWNTI---WKYFHLLNEE---------------R-------K------KICSFDAKANILKLI-DF-------------D-----------VL---RDSIVEVE-------------SL----CKRE-NS--PIVL---------CHCDLLSSNII---NTVG------D-SISF-IDFEYSCPMERAYDIAN-H-----------------FNE--------------------YAGFNCD------------WDLTPSK--------------EEEYH---FIMHYLG---T----------DD--------------EELI-------NQLIREIQPFYICSHINWGLWSLLQGMHSS----DFDFINYGMTRLTASCLPI-----------
39 HHSearch 66.2619% 14 - C2 - - 3C5I ? D:[17-365] -----------------------------------------IKKICLEKVP--E-W--NHFTEDNLRV----KQIL--LTNQLFEVGLK---------EETANNYNSIRT---------R---------VLFRIYGKHVDEL--YNTI---SEFEV-----YKTMSK-YKIA-PQLLNTF------------------NGGRIEEWLYG----D-P----------------LR--I--DDLK---NPTILIGIANVLGKFHT---L--SRK--RHLPE-H------------W-----DRTPC-----------IFKMM---EKWKNQLFKY---------------K-------NIEKYN-C---------------DI-------------HKYI--------KE---SDKFIKFM------------KVYSKSDN--L-AN--TIVF---------CHNDLQENNII---NTN-------K-CLRL-IDFEYSGFNFLATDIAN-F-----------------FIE--------------------TS-----------------IDYSVSSYPFFEIDKKKYISYENRKL---FITAYLS---N----------YLDKVVP---------TPKLI------DEILEAVEVQALGAHLLWGFWSIIRGYQTK-SYNEFDFFLYAEQRLKMYDDQKEYLISNNII--
4 PsiBlast_PDB 66.0123% -1 - C- - - 3DXQ - ? A:[27-255] ----------------------------------------------------------------------------GGLTNLVF----R---------A----------G---------D---------LCLRIPGK----Y--INRA---NEAVA-----AREAAK-AGVS-PEVLHVDP------------A----TGVMVTRYIAGAQTMS-P----------------EK--F--K--T---RPGSPARAGEAFRKLHGSG-A--VFP--FR-----------------F-----E---------------LFAMI---DDYLKVLS-----------------N-------V------TLPA------------GY-------------H-----------DV---VREAGGVR------------SAL----A--AHPL--PLAA---------CHCDPLCENFL---DTG-------E-RMWI-VDWEYSGMNDPLWDLGD-LSVE--------------GK---------------------FN-----------------A--------------------NQDEE---LMRAYFG---G----------EA--------------R----------PAERGRVVIYKAMCDLLWTL--------------------------------------------
45 HHSearch 63.7216% -12 - C2 - - 5FUT CHKA_HUMAN A:[11-376] ----------------------------------------RAYLWCKEFLP--GAW--RGLREDEFHI----SVIRGGLSNMLFQCSLP---------DTTATLGDEP-R---------K---------VLLRLYG------GAEAMV---LESVM-----FAILAE-RSLG-PKLYGIF------------------PQGRLEQFIPS----R-R----------------LD--T--EELS---LPDISAEIAEKMATFHG---M--KMP--FNK---E------------PK----W---------------LFGTM---EKYLKEVLRI---------------K-------FTEESRIK---------------KL-------------HK----------LL---SYNLPLELENL---------RSL----LEST-PS--PVVF---------CHNDCQEGNIL---LLEGRENSEKQ-KLML-IDFEYSSYNYRGFDIGN-H-----------------FCE--------------------WMYDYSYEKYPFFRANIRKYPTK-----------------KQQLH---FISSYLP---A----------FQNDFENLSTEEKSIIK----------EEMLLEVNRFALASHFLWGLWSIVQAKISS---IEFGYMDYAQARFDAYFHQKRKL--------
44 HHSearch 63.5616% -26 - C2 - - 5FTG CHKA_HUMAN A:[11-376] ----------------------------------------RAYLWCKEFLP--GAW--RGLREDEFHI----SVIRGGLSNMLFQCSLP---------DTTATLGDEP-R---------K---------VLLRLYG--------EAMV---LESVM-----FAILAE-RSLG-PKLYGIF------------------PQGRLEQFIPS----R-R----------------LD--T--EELS---LPDISAEIAEKMATFHG---M--KMP--FNK---E------------PK----W---------------LFGTM---EKYLKEVLRI---------------K-------FTEESRIK---------------KL-------------HK----------LL---SYNLPLELENL---------RSL----LEST-PS--PVVF---------CHNDCQEGNIL---LLEGRENSEKQ-KLML-IDFEYSSYNYRGFDIGN-H-----------------FCE--------------------WMYDYSYEKYPFFRANIRKYPTK-----------------KQQLH---FISSYLP---A----------FQNDFENLSTEEKSIIK----------EEMLLEVNRFALASHFLWGLWSIVQAKISS---IEFGYMDYAQARFDAYFHQKRKL--------
56 Fugue 63.4916% -19 - C2 - - 3ATS Y3168_MYCTU A:[1-357] ------------------------------------TLPAVISRWLSSVLP--G-GAAP---EVTVES----GVDSTGMSSETIILTAR---------W----------QQDGRSIQQ-K---------LVARV-APAAEDV--PVFPTYRLDHQFEVIRLVGELTD-VPVP-RVRWIETT------------GDVLGTPFFLMDYVEG----V-VPPDVMPYTFGDNWFADAP--A--E--R---QRQLQDATVAALATLHSIPNA--QNT--FS----F------------L-----TDTTLHR---------HFNWV---RSWYDFAVEGI--------------G-------R------S---------------PL-------------L-----------ER---TFEWLQSHW-----------PDD----A--A-AR--EPVL---------LWGDARVGNVL---YRD-------F-QPVAVLDWEMVALGPRELDVAW-MIFAHRVFQELAGLATLPGL---------------------PE-----------------V--------------------MREDD---VRATYQA---L----------TG--------------V------------ELGDLHWFYVYSGVMWACVFMRTGARRVHFG-----EIEKPDDVESLFYHAGLMKHLLGEEH
41 HHSearch 62.6216% -25 - C2 - - 3MES ? B:[73-411] -----------------------------------------------------------------IEV----KQIFSGLTNQLFVVSIV---------NELKH------P---------R---------ILFRIYGKHV--F--YDSK---VELDV-----FRYLSN-INIA-PNIIADF------------------PEGRIEEFIDG----E-P----------------LT--T--K--QLQ-LTHICVEVAKNMGSLHI---I--NSK--RADFPSR------------F-----DKEPI-----------LFKRI---YLWREEAKIQ---------------VSKNNQIDK------E---------------LY-------------S-----------KILEEIDQLEELIMGGEKFSMERALELK----LYSP-AF--SLVF---------AHNDLQENNLL---QTQ-------N-NIRM-IDYEYSAINFAGADIAN-Y-----------------FCE--------------------YI-----------------YDYCSEKQPYFKFKYEDYPCEELRKL---FISVYLS---Q----------TL--------------QEQVMPSQQIVHIMTKAVEVFTLISHITWGLWSIA--------SVEFDFTEYANTRFTHYLQKKKELID------
42 HHSearch 58.9016% -25 - C2 - - 3MES ? A:[73-411] -----------------------------------------------------------------IEV----KQIFSGLTNQLFVVSIV---------NELKH------P---------R---------ILFRIYGKHV-KF--YDSK---VELDV-----FRYLSN-INIA-PNIIADF------------------PEGRIEEFIDG----E-P----------------LT--T--K--QLQ-LTHICVEVAKNMGSLHI---I--NSK--RADFPSR------------F-----DKEPI-----------LFKRI---YLWREEAKIQ---------------VSKNNID-K------E---------------LY-------------S-----------KILEEIDQLEELIMGGEKFSMERALELK----LYSP-AF--SLVF---------AHNDLQENNLL---QTQ-------N-NIRM-IDYEYSAINFAGADIAN-Y-----------------FCE--------------------YI-----------------YDYCSEKQPYFKFKYEDYPCEELRKL---FISVYLS---Q----------TL--------------QEQVMPSQQIVHIMTKAVEVFTLISHITWGLWSIA---------VEFDFTEYANTRFTHYLQKKKELID------
47 HHSearch 54.4715% 1 - C2 - - 6EF6 ? A:[44-324] -----------------------------------------------------------------ASL----RLL-NLSENATYLVEDG---------E----------H---------Q---------SILRVHRQDYHQP--HEIE---SELDW-----LAALRTDSDVTVPTVVPARDGRRVVTVDPADVP----RHVVHFEMVGG----A-E----------------PD--E--E--SL--TLDDFQTLGRITASLHE---H--SQR--WTR---PAG----------FGRFSWD---------------WEHCLGDTPRWGRWQDAE---------------GV------GA-----SETA------------LL-------------T-----------RA---QDLLHRKL------------EEY----GS-G-PD--RYGL---------IHADLRLANLL---VDSSTPQ---R-TITV-IDFDDCGFGWYFYDFGT-A-----------------VSF--------------------IE-----------------HDPRLG---------------EWQES---WVAGYRS---R----------REL-------------P----------AADEAMLPSFVFLRRLLLLAWMGSHTHS------------------------------------