@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B2TNJ0_CLOBB: (2019-01-26 )
MFKDIENRFGAKIQDIKVLKSGWAGEIISLEFKDNTQKYVIKTYNSSKNGLENIKQEWTGLNLLYNANYPVPRPIISDFVNEKPYIVMEKIEGENLWTCYQTLSKEDRQQLLEKFVKVFLKLHELDVSIIDKELRKDSTSSFIEKEINEIKKLVEENKLEYFTQIIDWLQKEKANIIGEKLSIIHRDYHPWNVIVDNNKAIYVIDLLWGIGDYRFDLAWMYTLMERSGFEDFSQNALKKYKELKNQNINNFEYFKVFSTLRWLINVMISLKTGENLNETRNKEFENFVSPLIQNRIMSIKKITGIQITI

Atome Classification :

(24 SA) ----------.........10..---------....--..20......-...30....------....40......--..----50..----.......60.....-.--.-.70......---.-.-80----....----.....90...-..-..-.-100---------..---------......110.......-------------120......---------..------130..--------....-----.-140..---...-------..150...---..------.--------.-160-..-.......170-.-------...--.--..180.......190....-..--.200....-.-.-.210.......220.....--------------..---------230-..------------.......240.....-.-.250.......260.......270.......280.......290.......300.......
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ----------MFKDIENRFGAKI---------QDIK--VLK-SGWAGE-IISLEFKDN------TQKYVIKTYNSS--KN----G-LE----NIKQEWTGLNLLYN-A--N-YPVPRPIIS---D-F-V-----NEKP----YIVMEKIEGE-NL-WT-C-Y-Q---------TL---------SKEDRQQLLEKFVKVF-------------LK-LHELDV---------SI------IDKEL--------RKDS-----T-SSFIE---KEI-------NEIKKLVE---EN------K--------L-E---YF-TQIIDWLQKE-K-------ANI--I--GEKLSIIHRDYHPWNVIVD-NN--KAIYVIDL-L-W-GIGDYRFDLAWMYTLMERS--------------GF---------E---DF------------SQNALKKYKELKNQN-I-NNFEYFKVFSTLRWLINVMISLKTGENLNETRNKEFENFVSPLIQNRIMSIKKITGIQITI
41 Fugue 78.5016% 13 - C2 - - 3ATS Y3168_MYCTU A:[1-357] ---------TLPAVISRWLSSVLPGGAAPEVTVESG--VDS-TGMSSE-TIILTARWQQDGRSIQQKLVARVAPAA--ED----V-PVFPTYRLDHQFEVIRLVGE-LT-D-VPVPRVRWIETTG-D-V-----LGTP----FFLMDYVEGV-VP-PD-V-M-P---------YTFGDNWFADAPAERQRQLQDATVAAL-------------AT-LHSIPN---------AQ------NTFSF--------LTDT-----T-LHRHF---NWV-------RSWYDFAV---EGIG----R--------S-P---LL-ERTFEWLQSHWP-------DDA--A--AREPVLLWGDARVGNVLYR-DF--QPVAVLDW-E-MVALGPRELDVAWMIFAHRVF--------------QE---------L---AGLATLPGLPEVMREDDVRATYQALTGVE-L-GDLHWFYVYSGVMWACVFMRTGARRVHFGEIEKPDDVESLFYHAGLMKHLLGEEH------
57 HHSearch 78.1118% 22 - C2 - - 3ATT Y3168_MYCTU A:[22-318] --------------------------------VTVESGVDS-TGMSSE-TIILTARWQQDGRSIQQKLVARVAPAA--EDVPVFP-TY----RLDHQFEVIRLVGELT--D-VPVPRVRWI---ETTGDV----LGTP----FFLMDYVEGV-VP-PD-V-M-PYTFGDNWFADA---------PAERQRQLQDATVAAL-------------AT-LHSIPN---------AQN-----TFSFL--------T----------DTTLH---RHF-------NWVRSWYD---FA------VEGIG----R-S---PLLERTFEWLQSH-W--------PDDAA--AREPVLLWGDARVGNVLYR-DF--QPVAVLDW-E-MVALGPRELDVAWMIFAHRVF--------------QELAGLATLPGLPEVMR------------EDDVRATYQALTGVE-L-GDLHWFYVYSGVMWAC---------------------------------------------
56 HHSearch 77.4118% 25 * C2 * - 3ATS Y3168_MYCTU A:[22-318] --------------------------------VTVESGVDS-TGMSSE-TIILTARWQQDGRSIQQKLVARVAPAA--EDVPVFP-TY----RLDHQFEVIRLVGELT--D-VPVPRVRWI---ETTGDV----LGTP----FFLMDYVEGV-VP-PD-V-M-PYTFGDNWFADA---------PAERQRQLQDATVAAL-------------AT-LHSIPN---------AQN-----TFSFL--------T----------DTTLH---RHF-------NWVRSWYD---FA------VEGIG----R-S---PLLERTFEWLQSH-W--------PDDAA--AREPVLLWGDARVGNVLYR-DF--QPVAVLDW-E-MVALGPRELDVAWMIFAHRVF--------------QELAGLATLPGLPEVMR------------EDDVRATYQALTGVE-L-GDLHWFYVYSGVMWAC---------------------------------------------
63 HHSearch 71.1818% -36 - C2 - - 3DXP ? A:[39-317] ---------------------GP---------LSVE--QFK-G-QSNP-TFKLVTPG--------QTYVMRAKPG-----------------AIEREYRVMDALAG-T--D-VPVAKMYAL---CED-ESV---IGRA----FYIMEFVSGR-VL-WD-Q-SLP---------GM---------SPAERTAIYDEMNRVI-------------AA-MHTVDY---------QAI-----GLGDY--------GKP--------GNYFQ---RQI-------ERWTKQYK---LS------E--------T-ESI-PAMDSLMDWLPQH-I-------PQE--D--ADLTSIVHGDYRLDNLMFH-PTEPRVLAVLDW-E-LSTLGHPMGDFGYHCMSWHIAPGQFRGIAGLDHAALG---------I---PD------------EASYRKLYEQRTGRP-ITGDWNFYLAFSMFRIAG---------------------------------------------
75 HHSearch 69.8419% 9 - C2 - - 4DCA ? A:[36-288] -------------------QIKI---------NELR--YLS-SGDDSD-TFLC---N--------EQYVVKVPKRD--S-----V-RI----SQKRELELYRFLEN-CKLS-YQIPAVVYQ--------------SDR----FNIMKYIKGE-RI-TY-EQY-H---------KL---------SEKEKDALAYDEATFL-------------KE-LHSIEI---------DC-------SVSLF-------SDALVN---K-KDKFL---QDK-------KLLISILE---KE------QL-------LTDEMLEHIETIYENILSN-A--------VL--F--KYTPCLVHNDFSANNMIFR-NN--RLFGVIDF-G-DFNVGDPDNDFLCLLDCSTDD--------------FG---------K---EF------------GRKVLKYYQHKAPEV-AERKAELNDVYWSI-------------------------------------------------
43 Fugue 67.3415% 31 - C2 - - 3HAM ? A:[1-299] -------MVNLDAEIYEHLNKQI---------KINE--LRY-LSSGDD-SDTFLCNE---------QYVVKVP-KR--DS----V-RI----SQKREFELYRFLEN-C--K-LSYQIP--A---V-V-Y-----QSDR----FNIMKYIKGE-RITYE-Q-Y-H---------KL---------SEKEKDALAYDEATFL-------------KE-LHSIEI---------DC------SVSLFSDALVNKKDKFL-----Q-DKKLL---ISI-------LEKEQLLT---DE------M--------L-E---HI-ETIYENILNN-A-------VLF-----KYTPCLVHNDFSANNMIFR-NN--RLFGVIDFGD-F-NVGDPDNDFLCLLDCSTDD--------------FG---------K---EF------------GRKVLKYYQ--HKAP-E-VAERKAELNDVYWSIDQIIYGYERKD--------------REMLIKGVSELLQTQAEMFIF
6 PsiBlast_PDB 66.5524% -2 - C2 - - 5BYL AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTN--K----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
49 Fugue 66.3419% 51 - C2 - - 3JR1 ? A:[14-309] NLYFQGMWKSISQVLAEQFGAYY---------FIKH--KEK-LY-SGEMNEIWLINDE------VQTVFVKINERS--YR----SMF-------RAEADQLALLAK-T--NSINVPLVYGI---G-N-S-----QGHS----FLLLEALN----------------------------------KSKNKQSSFTIFAEKI-------------AQ-LHQIQGPDKYGLDFDTW------LGPIY--------QPNDWQTSWA-KFFSE---NRI-------GWQLQICK---EKGLIFGNI--------D-L---IV-QIVADTLSKH-N----------------PKPSILHGNLWIENCIQV-DD---KIFVCNP-A-C-YWGDRECDIAFS------S--------------LF---------E---PF------------PTNFYQRYNEIYPLE-E-GYLERKLIYQLYYLLNFSYRYYNKKQSYVSLTQKLINQILHK-------------------
10 PsiBlast_PDB 65.8524% 2 - C2 - - 5IQD AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFS----K----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
18 PsiBlast_PDB 65.6724% 2 - C2 - - 6CGG AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTN--K----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
11 PsiBlast_PDB 65.4224% 4 - C2 - - 5IQE AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTN--K----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
12 PsiBlast_PDB 64.9524% -1 - C2 - - 5IQF AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
1 PsiBlast_PDB 64.9324% -8 - C2 - - 5IQI AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-FA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
16 PsiBlast_PDB 64.4824% -1 - C2 - - 6CEY AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKF----------G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
7 PsiBlast_PDB 64.4524% -6 - C2 - - 5IQA AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
17 PsiBlast_PDB 64.4124% -2 - C2 - - 6CGD AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
13 PsiBlast_PDB 64.1624% -5 - C2 - - 5IQG AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------------------C--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
15 PsiBlast_PDB 64.1024% -4 - C2 - - 6CAV AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKF------------YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
9 PsiBlast_PDB 63.7824% -3 - C2 - - 5IQC AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFSCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
2 PsiBlast_PDB 63.5724% -3 - C2 - - 6CH4 AACA_STAAU A:[27-255] ---------------------KV---------DSIE--IIG-SGYD-----SVAYLVN------NE-YIFKTKFSTNKKK----G-YA----KEKAIYNFLNTNLE-T--N-VKIPNIEYS---Y-I-S-----DELS----ILGYKEIKGT-FL-TPEI-Y-S---------TM---------SEEE-QNLLKRDIASF-------------LRQMHGLDY---------TD------I-SEC--------TIDN-----K-QNVLE---EYILLRETIYNDLTD-IE---KD------Y--------I-E---SF-MERLN------A-------TTV--F--EGKKCLCHNDFNCNHLLLDGNN--RLTGIIDF-GDS-GIIDEYCDFIYLLEDSEEE--------------IG---------T---NF------------GEDILRMY-----------------------------------------------------------------------
59 HHSearch 62.0720% -11 - C2 - - 4R78 ? A:[37-277] --------------------EEV---------LSVE--QL--GGMTNQ-NYLAKTTN--------KQYIVKFFGKG--TE----K-LI----NRQDEKYNLELLKD-L--G-LDVKNYLFD---I----------EAG----IKVNEYIESAITL-DS-T-S--------------------------IKTKFDKIAPIL-------------QT-IHTSAK---------EL-------RGEF--------A----------P---F---EEI-------KKYESLIE---EQ------IPYAN----Y-E---SV-RNAVFSLEKR-L--------AD--L--GVDRKSCHIDLVPENFIES-PQ--GRLYLIDW-E-YSSMNDPMWDLAALFLESEF----------------T---------S---QE------------EETFLSHYESDQTPVSH-EKIAIYKILQDTIWSLWTVY-----------------------------------------
42 Fugue 56.2916% 36 - C2 - - 1J7L KKA3_ENTFL A:[2-264] ----------AKMRISPELKKLI---------EKYR--CVKDTEGMSP-AKVYKLVGE------NENLYLKMTDSRY-KG----T-TY----DVEREKDMMLWLEG----K-LPVPKVLHF---E-R-H-----DGWS----NLLMSEADGV-L---C-S-E-E---------YE---------DEQSPEKIIELYAECI-------------RL-FHSIDI---------SDCPYTNSLDSRL--------AELD-----Y-LLNND---LAD-------VDCENWEE---DT------P--------F-K---DP-RELYDFLKTE-K-------PE-------EELVFSHGDLGDSNIFVK-DG--KVSGFIDLGR-S-GRADKWYDIAFCVRSIREDI-------------GE---------E---QY------------VELFFDLLG--IKPD-W-EKIKYYILLDELF------------------------------------------------
44 Fugue 55.7315% 46 - C2 - - 3I1A ? A:[3-330] --KQPIQAQQLIELLKVHYGIDI---------HTAQ--FIQ-GGADTN-AFAYQADSE------SKSYFIKLKYGY--HD-------E----INLSIIRLLHDSGI-K--E-IIFPIHTLE---A-K-L-----FQQLKHFKIIAYPFIHAP-NG-FT-----Q---------NL---------TGKQWKQLGKVLRQIHETSVPISIQQQLRKE-IYSPKW---------RE------IVRSF--------YNQI-----E-FDNSD---DKL-------TAAFKSFF---NQ------N--------S-A---AI-HRLVDTSEKL-S-------KKI--QPDLDKYVLCHSDIHAGNVLVG-NE--ESIYIIDW-DEP-MLAPKERDLMFIGGGVGNV--------------WN---------K---PH------------EIQYFYEGYGEINVD-K-TILSYYRHERIVEDIAVYGQDLLSRNQNNQSRLESFKYFKEMFDPNNVVEIAFATE-----
72 HHSearch 48.7216% 21 - C2 - - 2Q83 COTI_BACSU A:[27-294] ---------------LQGWDVQA---------EKID--VIQ-----AL-VWKVHTDS--------GAVCLKRIHRP--E--------K----KALFSIFAQDYLAK-K--G-MNVPGILPN---KKG-SLYSKHGSFL----FVVYDWIEGR-PF-EL-T-V---------------------------KQDLEFIMKGL-------------AD-FHTASV---------GYQ-----PPNGVPIF-----TKLG-----RWPNHYTKRCKQM-------ETWKLMAEAEKED------PFSQLYLQEI-D---GFIEDGLRIKDRL-LQSTYVPWTEQ--L--KKSPNLCHQDYGTGNTLLG-EN--EQIWVIDL-D-TVSFDLPIRDLRKMIIPLLDTTGV-----------WD---------D---ET------------FNVMLNAYESRAPLT-E-E------------------------------------------------------------