@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B4D7J5_9BACT: (2019-01-26 )
MLAGCDRCRASSPPDPVNESAEFLQLLRQDGVVRTDDARLMPLTGGVSCEIYLVEDGAERFVVKRALAKLKVKADWFADICRNRYEWEFIRYVSRFLPAVVPALRHCSATGNYFAMEYLGGEFQNWKQQLLAGEARPEAAAQAGGLLAEIHRHSTGDAEAKRIFDTTPNFYQLRIEAYLLATGVKHPELRPLFEAEAARLAATRECLVHGDFSPKNILVSPERMVLLDCEVAWYGDPSFDLAFMLNHFFLKTLLHAPREVGMRRMVEAFWAAYQTGRPTPELETRVGRLLVMLLLARVDGKSPVEYLDVGRQDFVRQFARVMLHEEAPSLGVVTNAWFARLSQFTS

Atome Classification :

(24 SA) -.........10........-20--....----....30..-......40......-..50.-..-...-.-..60........70-....-....80.-.......90..-...-...100..--....-------.------------110-..-----.----......120...-....-.130---------..---------.--...-..140.......150-----------..-...----.-..---.---160-----.-------.--.--..---------....-----------170-.-.-.-------.-..-..---------------------180-------.--.---.----.---.-------.----------.------..---------190....---------..----.--.--200---.----.--.-----.-.-..---------..210.......220-----.-----.-..-.-.-..230.......240.......250.---------....-.-.--------------260-------.....---...-270....--..-----------------.280--------------------------.........290---.....-...300-.........310........320--...--....----..330..------.....340....--------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -MLAGCDRCRASSPPDPVNE-SA--EFLQ----LLRQDGVV-RTDDARLMPLTGGV-SCE-I-YL-VED-G-AERFVVKRALAKLK-VKAD-WFADICR-NRYEWEFIRYV-SRF-LPAVVPAL--RHCS-------A------------T---GN-----Y----FAMEYLGG-EFQ-NWKQ-QLL----------AG---------E--ARP-EAAAQAGGLLAEI-------------HR-HST----G-DA---E---A-------K-------R--I--FD---------TTPN-----------FY--Q-L-R-------I-EA-YL---------------------L---------A--T---G----V---K-------H----------P------EL---------R-PLFEA---------EA----A--R--L-----A----A--T-----R-E-CL---------VHGDFSPKNILVS-P-----E-----R-MV-L-L-DCEVAWYGDPSFDLAFMLNHFFLKTL---------LHAP-R-E--------------VG--------MRRMV---EAF-WAAYQTG--RP-----------------TP----------------------------ELETRVGRLLV----MLLLA-RVDG---KSPVEYLDVG-RQDFVRQFAR----VML--HEEA----PSLGVVT------NAWFARLSQFTS--------
34 HHSearch 78.7217% -64 - C1 - - 2PUL MTNK_BACSU A:[16-395] -------------------------SAVA----LAVKLGL-----TLTCQEIGDGN-LNY-V-FH-IY----DRALIIKQAVPYAK-V-ES-WPLTIDR-ARIESSALIRQ-GEH-VPHLVPRV--FYSD-------T------------E---MA-----V----TVMEDLSH--LK-IARK-GLI----------EG---------E--NYP-HLSQHIGEFLGKT-------------LF-YSS----D-YA---L---E-------PKVKKQLVK--Q--FT---------NPEL-----------CD--ITE-RLVFTDPFFDHD-TN---------------------D---------F--EEELR----PFVEK-------LWNN-------D------SV---------KIEAAK----------LK----K--S--F-----L----T--S-----A-E-TL---------IHGDLHTGSIFAS-E-----H-----E-TK-V-I-DPEFAFYGPIGFDVGQFIANLFLNAL---------SRDGAD-R--------------EPLYEH----VNQVW---ETF-EETFSEA--WQKDSLDVYANIDGYLTDTLS----------------------------HIFEEAIGFAG----CELIR-RTIGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEF----KTITDVI------ELFKLLV-------------
33 HHSearch 77.9219% -25 - C1 - - 2PYW MTK_ARATH A:[35-418] --------------------------------------------DDLVIKEVGDGN-LNF-V-FI-VVG-S-SGSLVIKQALPYIR-CIGESWPMTKER-AYFEATTLRKH-GNL-SPDHVPEV--YHFD-------R------------T---MA-----L----IGMRYLEPPH-I-ILRK-GLI----------AG---------I--EYP-FLADHMSDYMAKT-------------LF-FTS----L-LY---H---DTTEHRRAV-------T--E--FCGNVELCRLTEQVV-----------FSDPY-R-V---------ST-FN---------------------R---------W--T---S----P---Y-------LDDDAKAVREDS------AL---------KLEIAE----------LK----S--M--F-----C----E--R-----A-Q-AL---------IHGDLHTGSVMVT-Q-----D-----S-TQ-V-I-DPEFSFYGPMGFDIGAYLGNLILAFF---------AQDG-H-ATQENDRKEYKQWILRT--------IEQTW---NLF-NKRFIAL--WD-----------------QNKDGPGEAYLADIYNNTEVLKFVQENYMRNLLHDSLGFGA----AKMIR-RIVGVAHVEDFESIEEDKRRAICERSALEFAKMLLKERRKF----KSIGEVV------SAIQQ---------------
78 Fugue 76.1717% -25 - C1 - - 4OCV ? A:[24-378] -------------TNEALFD-VA--SHFA----L--------EGTVDSIEPYGDGH-INT-T-YL-VTT-D-GPRYILQRM-------NTG-IFPDTVN-LMRNVELVTST-LKA-QGKETLDI--VRTT-------S------------G---DT-----W----AEIDGGAW-RVY-KFIE-HTM----------SY---------NLVPNP-DVFREAGRAFGDF-------------QN-FLS----G--F---D---A-------N-------Q--L--TE---------TIAH-----------FH--D-T-P-------H-RF-ED---------------------F---------K--K---A----L---A-------A----------D------ELGRAAGCGPEI-EFYLS---------HA----D--Q--Y-----A----V--V-----M-D-GLRDGSIPLRVTHNDTKLNNILMD-ATTG--K-----A-RA-I-I-DLDTIMPGSMLFDFGDSIRFGAS-TA---------LEDE-R-D--------------LDKVHFSTELFRAYT---EGF-VGELRDSITAR-----------------EA----------------------------ELLPFSGNLLTMECGMRFLA-DYLE---GDVYFATKYP-EHNLVRSRTQ----IKL--VREM----EQRADET------RAIVADVMETT---------
64 Fugue 75.8417% -59 - C1 - - 2OLC MTNK_BACSU A:[5-396] -----------KTPLYETLN-ES--SAVA----LAVKLG-----LTLTCQEIGDGN-LNY-V-FH-IYD----RALIIKQAVPYWP-LTID-------R-ARIESSALIRQ-GEH-VPHLVPRV--FYSD-------T------------E---MA-----V----TVMEDLSH--LK-IARK-GLI----------EG---------E--NYP-HLSQHIGEFLGKTLFYS---------SD-YAL----E-PK---V---K-------K-------Q--L--VK---------QFTN-----------PE--L-C-D-------I-TE-RLVFTDPFFDHDTNDFEEELRPFV---------E--K---L----W---N-------N----------D------SV---------K-IEAAK---------LK----K--S--F-----L----T--S-----A-E-TL---------IHGDLHTGSIFAS-E-----H-----E-TK-V-I-DPEFAFYGPIGFDVGQFIANLFLNALSRDGADREPLYEH-V-N--------------QV--------WETFE---ETF-SEAWQKD--SL-----------------DVYANIDGYLTDTLS---------------HIFEEAIGFAG----CELIR-RTIG---LAHVADLDTI-VPFDKRIGRK----RLA--LETG----TAFIEKRSEFKTITDVIELFKLLVK--------
35 HHSearch 73.5417% -63 - C1 - - 2OLC MTNK_BACSU A:[16-395] -------------------------SAVA----LAVKLGL-----TLTCQEIGDGN-LNY-V-FH-IY----DRALIIKQAVPY--------WPLTIDR-ARIESSALIRQ-GEH-VPHLVPRV--FYSD-------T------------E---MA-----V----TVMEDLSH-L-K-IARK-GLI----------EG---------E--NYP-HLSQHIGEFLGKT-------------LF-YSS----D-YA---L---E-------PKVKKQLVK--Q--FT---------NPEL-----------CD--ITE-RLVFTDPFFDHD-TN---------------------D---------F--EEELRPFV-E---K-------LWNN-------D------SV---------KIEAAK----------LK----K--S--F-----L----T--S-----A-E-TL---------IHGDLHTGSIFAS-E-----H-----E-TK-V-I-DPEFAFYGPIGFDVGQFIANLFLNAL---------SRDG-ADR--------------EPLYEH----VNQVW---ETF-EETFSEA--WQKDSLDVYANIDGYLTDTLS----------------------------HIFEEAIGFAG----CELIR-RTIGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEF----KTITDVI------ELFKLLV-------------
73 Fugue 65.4317% -8 - C1 - - 3ATS Y3168_MYCTU A:[1-357] TLPAVISRWLSSVLPGGAAP-EV--TVES----GVDSTG---MSSETIILTARWQQ-D--------GRS-I-QQKLVARVAPAAED-VPV----FPTYR-LDHQFEVIRLV-GEL-TDVPVPRV--RWIE-------T------------T---GDVLGTPF----FLMDYVEG-VVP-PDVM-PYT----------FGDNWFADAPAE--RQR-QLQDATVAALATL-------------HS-IPN----A-QN---T---F-------S-------F--L--TD---------TTLH-----------RH--F-N-W-------V-RS-WY---------------------D---------F--A---V----E---GIGR----S----------P------LL---------E-RTFEW---------LQSHWPD--D--A-----A----A--R-----E-P-VL---------LWGDARVGNVLYR-DF----Q-----P-VA-V-L-DWEMVALGPRELDVAWMIFAHRVFQE---------LAGL-A-T--------------LP--------GLPEVMREDDV-RATYQAL--TG-----------------VE----------------------------LGDLHWFYVYS----GVMWA-CVFM---RTGARRVHFG-EIEKPDD---------V--ESLF----YHAGLMK------HLLGEEH-------------
3 PsiBlast_PDB 63.2120% -18 - C1 - - 2PYW MTK_ARATH A:[8-277] ----------------PLNE-KSLVDYIKSTPALSSKIGAD-KSDDDLVIKEVGDG-NLNFV-FI-VVG-S-SGSLVIKQALPYIRCIGES-WPMTKER-AYFEATTLRKH-GNL-SPDHVPEV--YHFD-------R------------T---MA-----L----IGMRYLEP-PHI-ILRK-GLI----------AG---------I--EYP-FLADHMSDYMAKTLFFTSLLYHDTTEHR-RAVTEFCG-NV---E---L-------C-------R--L--TE---------QVVF-----------SD--P-Y-R-------V-ST-FN---------------------RWTSPYLDDDA--K---A----V---R-------E----------D------SA---------L-KLEIA---------EL----K--S--M-----F----C--E-----RAQ-AL---------IHGDLHTGSVMVT-Q-----D-----S-TQ-V-I-DPEFSFYGPMGFDIGAYLGNLIL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
69 Fugue 59.5218% -13 - C1 - - 3CSV ? A:[4-333] ---------------SREDE-IR--DFLA----THGYADWN-RTPRYQRLRSPTGA-KAV-LMDW-SPE-E-GGDTQPFVDLAQYL-RNLD-I--------------------------SAPEI--YAEE-------H------------A---RG-----L----LLIEDLGD-A---LFTE-VIN----------ND---------P--AQEMPLYRAAVDLLIHL-------------HD-AQT----P-EL---ARLDP-------E-------T--L--SEM--------TRLA-----------FS--E-Y-R-------Y-AI-LG---------------------D---------A--A---E----D---N-------R----------K------RF---------E-HRFAQ---------IL----S--A--Q-----L-------E-----G-DMVF---------VHRDFHAQNLLWL-PEREGLA-----R-VG-V-I-DFQDAKLGHRAYDLVSLLQDARRD-------------------------------------------VPAQV---EAQMIDHYIQA--TG-----------------VD----------------------------ESHFRSAYAVI----AVQRNMRILG---IFARLSQRFG-KRHYIEFVPR----VWA--HFERGLAHPALASAA------EEILNALPAPAPEVLERLRA
1 PsiBlast_PDB 57.5523% -29 - C1 - - 2PUL MTNK_BACSU A:[58-275] ---------------------------------------------------------------------------LIIKQAVPYAK-V--ESWPLTIDR-ARIESSALIRQ-GEH-VPHLVPRV--FYSD-------T------------E---MA-----V----TVMEDLS--HLK-IARK-GLI----------EG---------E--NYP-HLSQHIGEFLGKT-------------LF-YSS----D-YA---L---E-------P-------K--V--KKQLVKQF---TNPE-----------LC--D-I-T-------E-RL-VF---------------------T---------D--P---F----F---D-------H----------DTNDFEEEL---------R-PFVEKLWNNDSVKIEA----A--K--L-----KKSFLT--S-----A-E-TL---------IHGDLHTGSIFAS-E-----H-----E-TK-V-I-DPEFAFYGPIGFDVGQFIANLFLNAL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 57.0723% -33 - C1 - - 2PUN MTNK_BACSU A:[58-275] ---------------------------------------------------------------------------LIIKQAVPYAK-VVGESWPLTIDR-ARIESSALIRQ-GEH-VPHLVPRV--FYSD-------T------------E---MA-----V----TVMEDLS--HLK-IARK-GLI----------EG---------E--NYP-HLSQHIGEFLGKT-------------LF-YSS----D-YA---L---E-------P-------K--V--KKQLVKQF---TNPE-----------LC--D-I-T-------E-RL-VF---------------------T---------D--P---F----F---D-------H----------DTNDFEEEL---------R-PFVEKLWNNDSVKIEA----A--K--L-----KKSFLT--S-----A-E-TL---------IHGDLHTGSIFAS-E-----H-----E-TK-V-I-DPEFAFYGPIGFDVGQFIANLFLNAL------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
38 HHSearch 55.5622% -52 - C1 - - 5UXD ? A:[8-253] ----------------------D--ALLD----LAARHGLD--LDGGTLRTEEIGL-DFR-V-AF-ARAHD-GGDWVLRLPRRPD----------VLER-AAVEGRLLAML-APH-LDVAVPDW--RIST------------------------SE-----L----IAYPLLPG---S-PGLT-VAA----------DGEVSWHVD--M--AST-VYARSLGSVVAQL-------------HA-VDA----E-AA---A---A-------T----------G--IE---------VRSP-----------AQV-R-G-A-------W-RQ-DL---------------------A---------R--V---G----AEF-E-------IA---------P------AL---------RERWEA----------WL----A--DDGC-----W----P--G-----H-S-VL---------THGELYPAHTLVE-D-----E-----RITA-V-L-DWTTAAVGDPAKDLMFHQVSA----------------------------------------------PSAIF---EVA-LQAYAEG--GG--------------------------------------------------------------------------------------------------------------------------------------------------
67 Fugue 55.5016% -48 - C1 - - 2PPQ - KHSE_AGRFC A:[5-320] ---------------TDIT--ED--ELRN----FLTQYDV------GSLTSYKGIA-ENS-N-FL-LHT-T-KDPLILTLY-----------------E-KKNDLPFFLGLMQHL-AAKGLSCP--LPLP-------R------------K---DG-----E----LLGELSGR-PAA-LISF---L----------EGM--------W--LRK-PEAKHCREVGKAL-------------AAMHLA----SEGF---E---I-------K-------R--P--NA---------LSVD-----------GW--K-V-L-------W-DK-SE---------------------E---------R--A---D----E---V-------E----------K------GL---------R-EEIRP---------EI----D--Y--L-----A----A--HWPKDLP-A-GV---------IHADLFQDNVFFLGD-----E-----L-SG-L-I-DFYFACNDLLAYDVSICLNAWCFE--------------K-D-G--------------AY--------NVTKG---KAL-LEGYQSV--RP-----------------LS----------------------------EAELEALPLLS----RGSAL-RFFL---TRLYDWLTTP-AGALVVKKDP----LEY--LRKL----RFHRTIA------NVAEYGLA------------
43 HHSearch 55.4518% -34 - C1 - - 6EF6 ? A:[27-294] -------------------D-VT--IAQQ----ALTHYDVS---DNASLRLL-NLS-ENA-T-YL-VED-G-EHQSILRVHRQDYH---------QPHE-IESELDWLAAL-RTD-SDVTVPTV--VPAR-------DGRRVVTVDPADVP---RH-----V----VHFEMVGG---A-EPDE-E-----------------------S--LTL-DDFQTLGRITASL-------------HE-HSQ----R-WT---R---P-------AGF-----G--RFSWD---------WEHC-----------LGD-T-P-R-------W-GR-WQ---------------------D---------AEGV---GASETA---L-------L----------T------RA---------QDLLHR----------KL----E--E--YGS---G----P--D-----R-Y-GL---------IHADLRLANLLVD-S-----STPQR-T-IT-V-I-DFDDCGFGWYFYDFGTAVSFIEHDP-----------R------------------------------LGEWQ---ESW-VAGYRSR--RE--------------------------------------------------------------------------------------------------------------------------------------------------
39 HHSearch 54.8516% -48 - C1 - - 3DXQ - ? B:[4-249] ----------------------D--EARA----KLAAIPML--AGYTGPLERLGGL-TNL-V-FR-A------GDLCLRIP-----------------N-RANEAVAAREA-AKA--GVS-PEV--LHVD-------P------------A---TG-----V----MVTRYIAG---AQTMSP-EKF---------------------K--TRP-GSPARAGEAFRKL-------------HG-SGA----V-FP---F---R-------F----------E--LF---------AM-I-----------DD--Y-LKV-------L-ST-KN---------------------V---------T--L---P----A---G-------Y----------H------DV---------VREAGG----------VR----S--A--LAA---H----P--L-----P-L-AA---------CHCDPLCENFLDT-G-----E-----R-MW-I-V-DWEYSGMNDPLWDLGDLSVEGKF--------------------------------------------NANQD---EEL-MRAYFGG--EA-----------------RP----------------------------AERGRVVIYKA----MC----------------------------------------------------------------------------------
48 HHSearch 52.8013% -58 * C1 * - 3TDW ? A:[6-276] ----------------------L--HYTT----MIMTQ-FP-DISIQSVESLGEGF-RNY-A-IL-VN-----GDWVFRFPKSQQ----------GADE-LNKEIQLLPLL-VGC-VKVNIPQY--VYIG-------KRSD---------G---NP-----F----VGYRKVQG---Q-ILGE-DGMAVL-------PD---------D--AKD-RLALQLAEFMNEL-------------SA-FPV----E-TA---I---S-------A----------G--VP---------VTNL-----------KNK-I-L-L-------L-SEAVE---------------------DQVFP-----L--L---D----E---S-------LR---------D------YL---------TLRFQS----------YM----T--HPVY-----T----R--Y-----T-P-RL---------IHGDLSPDHFLTN-LNSRQ-T-----P-LTGI-I-DFGDAAISDPDYDYVYLLEDCGE-----------------------------------------------LF---TRQ-VMAYRGE--VD-----------------LD----------------------------THIRKVSLFVT----FDQVS-YLLE--------------------------------------------------------------------------
71 Fugue 52.4813% -24 - C1 - - 3HAM ? A:[1-299] -MVNLDAEIYEHLNKQIKIN-EL--RYLS----SGDDSDTF-LCNEQYVVKVPKR-----------------------DSVRISQK-REFE-LYRFLEN-CKLSYQIPAVV-YQS-DR-------------------------------------------F----NIMKYIKG-ERI-TYEQYHKL----------SE---------K--EKD-ALAYDEATFLKEL-------------HS-IEIDC--S-VS---L---F-------S-------D--A--LV---------NKKD-----------KF--L-Q-D-------K-KL-LI---------------------S---------I--L---E----K---EQLLTDEML----------E------HI---------E-TIYEN---------IL----N--N--A-----V----LFKY-----T-P-CL---------VHNDFSANNMIFR-N-----N-----R-LF-G-VIDFGDFNVGDPDNDFLCLLDCS----------------------------------------------------------------------------------------------------------------------TDDFGKEFG----RKVLK-YYQH---KAPEVAERKA-ELNDVYWSID----QII--YGYE----RKDREML------IKGVSELLQTQAEMFIF---
66 Fugue 51.5615% -16 - C1 - - 3JR1 ? A:[14-309] --------------NLYFQGMWK--SISQ----VLAEQFGA-YYFIKHKEKLYSGEMN-E-I-WL-IND-E-VQTVFVKINERSYR------------SMFRAEADQLALL-AKT-NSINVPLVYGIGNS-------Q------------G---HS-----F----LLLEALN------------------------KS---------K--NKQ-SSFTIFAEKIAQL-------------HQ-IQG----P-DKYGLD---F-------D-------T--W--LG---------PIYQPNDWQTSWAKFFS--E-N-R-------I-GW-QL---------------------Q---------I--C---K----E---K-------G----------L------IFGN-------I-DLIVQ---------IV----A--D--T-----L----S--KHNP--K-P-SI---------LHGNLWIENCIQV-D-----D-----K-IF-V-C-NP-ACYWGDRECDIAFSSLF------------------------------------------------EPFP---TNF-YQRYNEI--YP-----------------LEEGY-------------------------LERKLIYQLYY----LLNFS-YRYY---NKKQSYVSLT-QKLINQILHK--------------------------------------------------
65 Fugue 51.3315% -41 - C1 - - 1J7L KKA3_ENTFL A:[2-264] ---------------AKMRI-SP--ELKK----LIEKYRCV-KDTE-------GMS-PAK-V-YK-LVG-E-NENLYLKMTDSRYK-GTTY-------D-VEREKDMMLWL-EGK-LPVPKVLH--FERH-------D------------G---WS-----N----LLMSEADG---V-LCSE-EYE----------DE---------Q--SPE-KIIELYAECIRLF-------------HS-IDI----S-DC---P---Y-------T-------N--S--LD---------SRLA-----------EL--D-Y-L-------L-NN-DL---------------------A---------D--V---D----C---E-------NWEEDTPF---K------DP---------R-ELYDF---------LK----T--E--K-----P----E--E-----E-L-VF---------SHGDLGDSNIFVK-D-----G-----K-VS-GFI-DLGRSGRADKWYDIAFCVRSIREDI---------------------------------G--------EEQYV---ELF-FDLL--G--IK-----------------PD----------------------------WEKIKYYILLD----ELF---------------------------------------------------------------------------------
46 HHSearch 50.8719% -46 - C1 - - 1ZYL - SRKA_ECOLI A:[12-257] -------------------H-PD--TIMD----ALFEHGIR---VDSGLTPL-NSY-ENR-V-YQ-FQDED-RRRFVVKFYRPERW---------TADQ-ILEEHQFALQL-VND--EVPVAAP--VAFNGQTLLNHQ------------G---FY-----F----AVFPSVGG---R-QFEA-D---------------------------NI-DQMEAVGRYLGRM-------------HQ-TGR----K-QL---F---I-------H-------RP-T--IG---------LNEY-----------LIE-P-R-KL------F-ED-A----------------------T---------L--I---P----S---G-------LK---------A------AF---------LKATDE----------LI----A--A--VTAHWRE----D--F-----T-V-LR---------LHGDCHAGNILWR-D-----------G-PM-F-V-DLDDARNGPAVQDLWMLLNGDKAE-------------------------------------------QRMQL---ETI-IEAYEEF--SE--------------------------------------------------------------------------------------------------------------------------------------------------
40 HHSearch 50.1716% -47 - C- - - 3DXQ - ? A:[4-249] ----------------------D--EARA----KLAAIPML--AGYTGPLERLGGL-TNL-V-FR-A------GDLCLRIPGK-------------YIN-RANEAVAAREA-AKA--GVS-PEV--LHVD-------P------------A---TG-----V----MVTRYIAG---AQTMSP-EKF---------------------K--TRP-GSPARAGEAFRKL-------------HG-SGA----V-FP---F---R-------F----------E--LF---------AM-I-----------DD--Y-LKV-------L-S---N---------------------V---------T--L---P----A---G-------Y----------H------DV---------VREAGG----------VR----S--A--LAA---H----P--L-----P-L-AA---------CHCDPLCENFLDT-G-----E-----R-MW-I-V-DWEYSGMNDPLWDLGDLSVEGKF--------------------------------------------NANQD---EEL-MRAYFGG--EA-----------------RP----------------------------AERGRVVIYKA----MC----------------------------------------------------------------------------------
36 HHSearch 48.1917% -27 - C1 - - 3CSV ? A:[6-252] ---------------------ED--EIRD----FLATHGY----ADWNRTP----------R-YQRLRS-PTGAKAVLMDWSPE-----------EGGD-TQPFVDLAQYL-RNL--DISAPEI--YAEE-------H------------A---RG-----L----LLIEDLGD---A-LFTE-VIN----------NDP--------A--QEM-PLYRAAVDLLIHL-------------HD-AQT----P-EL---A---R---------------------LD---------PETL-----------SEM-T-RLA-------F-SE-YR---------------------YA--------I--L---GDAAED---N-------R----------K------RF---------EHRFAQ----------IL----S--A--Q-----L----E--G-----D-M-VF---------VHRDFHAQNLLWL-P-----EREGLAR-VG-V-I-DFQDAKLGHRAYDLVSLLQDARRDV------------------------------------------PAQVE---AQM-IDHYIQA--TG--------------------------------------------------------------------------------------------------------------------------------------------------
42 HHSearch 47.4117% -53 - C1 - - 5IGI ? A:[9-256] ---------------------TS--QLYA----LAARHGLK---LHGPLTVNELGL-DYR-I-VI-ATV-DDGRRWVLRIPRRAE----------VSAK-VEPEARVLAML-KNR-LPFAVPDW--RVAN-------A------------ELVAYP-----MLEDSTA-VIQPG---S-STPD-WV-----------VP---------Q--DSE-VFAESFATALAAL-------------HA-VPI----S-AA---V---D-------A-------G--M--LIRT-------PTQA-----------RQK-V-A-DD------V-DR-VR---------------------R---------E--F---V----V---N-------D----------K------RL---------H-RWQRW---------LD----D--DS-S-----W----P--D-----F-S-VV---------VHGDLYVGHVLID-NT----ER----V-SG-M-I-DWSEARVDDPAIDMAAHLMVFG----------------------------------------------EEGL---AKL-LLTYEAA--GG--------------------------------------------------------------------------------------------------------------------------------------------------
44 HHSearch 45.3215% -25 - C1 - - 5IWU ? A:[6-256] ----------------------K--QVIE----IAKKHNLF--LKEETIQFNESGL-DFQ-A-VF-AQDNN-GIDWVLRLPRRED----------VMPR-TKVEKQALDLV-NKYAISFQAPNW--IIYT------------------------EE-----L----IAYKKLDG---V-PAGT-IDHNIGNYIWEIDIN---------N--VPE-LFHKSLGRVLAEL-------------HS-IPS----N-KA---A---A-------L-------DLVV--HT---------PEEA-----------RMS-M-K-QR------M-DA-VR---------------------A---------K--F--------G---V-------G----------E------NL---------WNRWQA----------WL----NDDD--M-----W----P--K-----K-T-GL---------IHGDVHAGHTMID-KD----A-----N-VTGL-I-DWTEAKVTDVSHDFIFNYRAF----------------------------------------------GEEGL---EAL-ILAYKEI--GG--------------------------------------------------------------------------------------------------------------------------------------------------
50 HHSearch 37.6317% 31 - C1 - - 4R78 ? A:[19-253] -----------------SHM-EK--IIKE----KISSL-LSQEEEVLSVEQL-GGM-TNQ-N-YL-AKT-T-NKQYIVKFFGKGTE---------KLIN-RQDEKYNLELL-KDL--GLDVKNY--LFDI--------------------E---AG-----I----KVNEYIES---AITLDS-T--------------------------SIK-TKFDKIAPILQTI-------------HT-SAK----E-LR---G---E-------F-------A--P--FE---------EIKK-----------Y---E-S-L-------I-EE-QI---------------------P---------Y-----------A---N-------Y----------E------SV---------RNAVFS----------LE----K--R--L-----ADL--G--V-----D-R-KS---------CHIDLVPENFIES-PQ----G-----R-LY-L-I-DWEYSSMNDPMWDLAALFLESEF--------------------------------------------TSQEE---ETF-LSHYESD--QT--------------------------------------------------------------------------------------------------------------------------------------------------