@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B4D9C8_9BACT: (2019-01-26 )
MEEDRRHPRRQLDPALIASYLAGRKIELVQLMPLGKSNTNYRLTLADGEVCLLRLHHPGANAERENHILRLVREIVPVPAVLASGSDWSIHSFVEGIPLADAPESVHAAAEALARIASLRFTSSGWIQADGSIAPFDFGDGKSFVESMLERADVRAWVGADTAAALRRIEAAQPPAADDEPRLVHGDFNPTNILVHQRAVTGILDWEFSHAGSPYMDIGNLLRHTDPAQHGALEAGLVAGGLNVPADWRQQAEMVDLSSHLEFLTTQRSDAFKQRCADWIRDFVERY

Atome Classification :

(24 SA) ---------------------------------.........10........20..-.------.....30...--....-.40....-.-.--------.-------.50......----..-----60-------..-......-.70....----.------....80---------....-------.--------------.-----.---------.----.90.....------------------.-.----.100------.-----.---------.-.-----....110...-....120-.......130-..------......140..----..------...150.--------.---...-------..160-....----.....170---.-.---.---.-.--..------180---.......190.....----.------.200..--.....210.......220..--------.------------.--------------------...230.......240....-----....250.......260..-......270.......280.....-----------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ---------------------------------MEEDRRHPRRQLDPALIASYLAG-R------KIELVQLMPL--GKSN-TNYRLTL-A-D--------G-------EVCLLRLHH----PG-----A--------NA-ERENHI-LR-LVRE----I------VPVPA----------VLAS-------G--------------S-----D---------W----SIHSFVEG------------------I-P----LAD-------A-----P---------E-S-----VHAAAEALAR-IASLRFT-SSGWIQADG--SI------APFDFGDGKSF----VE------SMLERAD--------V---RAW-------VGA---DTAA----ALRRIEAA---Q-P---P---A-A--DD------EPR---LVHGDFNPTNILVHQ----R------AVTGIL--DWEFSHAGSPYMDIGNLLRH--------T------------D--------------------PAQHGALEAGLVAG-GLNVP-----ADWRQQAEMVDLSSH-LEF-LTTQRSDAFKQRCADWIRDFVERY-----------------------------
2 PsiBlast_PDB 75.6922% -23 - C4 - - 3W0N KHYB_ECOLX A:[9-233] -----------------------------------------------TSVEKFLIE-K------FGSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-TELPAVLQPVAEVMDA-IAAADLSQTSGF----G--PF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHADFGSNNVLTDN----G------RITAVI--DWSEAMFGDPLYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
3 PsiBlast_PDB 75.5022% -25 - C4 - - 3W0O KHYB_ECOLX A:[9-233] -----------------------------------------------TSVEKFLIE-K------FGSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-TELPAVLQPVAEVMDA-IAAADLSQTSGF----G--PF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHADFGSNNVLTDN----G------RITAVI--DWSEAMFGDPLYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
31 Fugue 75.2115% -39 - C4 - - 2PPQ - KHSE_AGRFC A:[5-320] ------------------------------------------TDITEDELRNFLTQ-Y------DVGSLTSYKG--IAEN-SNFLLHT-T-K--------D-------P-LILTLYE----KK-----N--------DL-PFFLGLMQH-LAAK----G------LSCPLPLPRKDGELLGELS-------G--------------R-----P---------A----ALISFLEGM-----------------W-L----RKP-------E-----A---------K-H-----CREVGKALAAMHLASEGF-EIK--------RP------NALSVDGWKVL----WD------KSEERADE-------V---EKG-------LRE---EIRP----EIDYLAAH---W-P---K---D-L----------PAG---VIHADLFQDNVFFLG----D------ELSGLI--DFYFACNDLLAYDVSICLNAWCFEKDGAY------------N--------------------VTKGKALLEGYQSV-RPLSE-----AELEALPLLSRGSAL-RFF-LTRLYDWLTTPAGALVVKKDPLEYLRKLRFHRTIANVAEYGLA----------
4 PsiBlast_PDB 74.9222% -29 - C4 - - 3W0R KHYB_ECOLX A:[9-233] -----------------------------------------------TSVEKFLIE-K------FGSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-TELPAVLQPVAEVMDA-IAAADLSQTSGF----G--PF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHADFGSANVLTDN----G------RITAVI--DWSEAMFGDPLYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
25 Fugue 74.7620% -4 - C4 - - 3ATS Y3168_MYCTU A:[1-357] -----------------------------------TLPAVISRWLSSVLPGGAAPE-V------TVESGVD-ST--GMSS-ETIILTA-R-W--------QQDGRSIQQKLVARVAP----AA-----EDVPVFPTYRL-DHQFEV-IR-LVGE----LTD----VPVPR----------VRWIETTGDVLG--------------T-----P---------F----FLMDYVEGVVPPDVMPYTFGDNWFADA-P----AER-------Q-----R---------Q-L-----QDATVAALAT-LHSIPNA-QNTF----S--FL------TDTTLHRHFNW----VR------SWYDFAV--------E---GIG-------RSP---LLER----TFEWLQSH---W-P---D---DAA--AR------EPV---LLWGDARVGNVLYRD----F------QPVAVL--DWEMVALGPRELDVAWMIFA--------H------------R--------------------VFQELAGLATL-PG-LPEVM-----REDDVRATYQALTGVELGD-LHWFYVYSGVMWACVFMRTGARRVHFGEIEKPDDVESLFYHAGLMKHLLGEEH
30 Fugue 74.6517% -2 - C4 - - 1ZYL - SRKA_ECOLI A:[4-328] -------------------------------------SAFTFQTLHPDTIMDALFE-H------GIRVDSGLTPLNSYEN-RVYQFQD-E-D--------R-------RRFVVKFYR----PERWTA-D--------QI-LEEHQF-AL-QLVN----DE-----VPVAA----------PVAF-------N--------------G-----QTLLNHQGFYF----AVFPSVGG------------------RQF----EAD-------N-----I---------D-Q-----MEAVGRYLGR-MHQTG---------RKQ--LF------IHRPTIGLNEY----LI------EPRKLFE--------D---ATL-------IPS---GLKA----AFLKATDE---L-I---A---A-V--TAHWREDFTVL---RLHGDCHAGNILWRD----G--------PMFV--DLDDARNGPAVQDLWMLLNG--------D------------K--------------------AEQRMQLETIIEAY-EEFSEFDTAEIGLIEPLRAMRLVYY-LAW-LMRRWADPAFPKNFPWLTG--EDYWLRQTATFIEQAKVLQEPPLQLTPMY---
5 PsiBlast_PDB 74.2422% -24 - C4 - - 3W0P KHYB_ECOLX A:[9-233] -----------------------------------------------TSVEKFLIE-K------FGSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-TELPAVLQPVAEVMDA-IAAADLSQTSGF----G--PF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHAAFGSNNVLTDN----G------RITAVI--DWSEAMFGDPLYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 74.1921% -40 - C4 - - 3W0S KHYB_ECOLX A:[6-233] --------------------------------------------LTATSVEKFLIE-K------FDSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-T-----ELPAVLQPVA-EAMDAIA-AADLSQTSGFGPF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHADFGSNNVLTDN----G------RITAVI--DWSEAMFGDSQYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 73.7322% -23 - C4 - - 3W0M KHYB_ECOLX A:[11-233] -------------------------------------------------VEKFLIE-K------FGSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-TELPAVLQPVAEVMDA-IAAADLSQTSGF----G--PF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHADFGSNNVLTDN----G------RITAVI--DWSEAMFGDPLYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 73.2422% -22 - C4 - - 3W0Q KHYB_ECOLX A:[8-233] ----------------------------------------------ATSVEKFLIE-K------FGSVSDLMQL--SEGE-ESRAFSFDV-G--------G-------RGYVLRVNS----CA-----D--------GF-YKDRYV-YRHFASA----A------LPIPE----------VLDI-------G--------------EFSESLT---------Y----CISRRAQG------------------V-T----LQD-------L-----P---------E-TELPAVLQPVAEVMDA-IAAADLSQTSGF----G--PF------GPQGIGQYTTW----RD------FICAIADPH------V---YHWQTVMDDTVSA---SVAQ----ALDELMLW---------------A--ED------CPEVRHLVHADFGSNAVLTDN----G------RITAVI--DWSEAMFGDPLYEVANIF----------------------------------------------------------------------------------------------------------------------------------------------
23 Fugue 72.8417% -7 - C4 - - 1J7L KKA3_ENTFL A:[2-264] ----------------------------------------AKMRISPELKKLIEKY-R------CVK----DTE--GMSP-AKVYKLV-G-E--------N-------ENLYLKMTD----SRYKGTTY--------DV-EREKDM-ML-WLEG----K------LPVPK----------VLHF-------E--------------R-----HDGWS-----N----LLMSEADG------------------V-L----CSEEYEDEQSP-----E---------K-I-----IELYAECIRL-FHSIDIS-DCPYTNSLD--SR------LAELDYLLNND----LA------DVDCENW--------E---EDT-------PFK---DPRE----LYDFLKTE---K-P---E---------E------ELV---FSHGDLGDSNIFVKD----G------KVSGFI--DLGRSGRADKWYDIAFCVRS--------I------------R--------------------EDIGEEQYVELFFD-LLGIK-----PD----WEKIKYYIL-LDE-LF---------------------------------------------------
48 HHSearch 72.6116% -45 - C4 - - 3TDW ? A:[4-276] -----------------------------------------NKLHYTTMIMTQFPD-I------SIQSVESLGE--GFRN-YAILV-----N----------------GDWVFRFPK----SQ-----QGA------DELNKEIQL-LP-LLVGCV--K------VNIPQ----------YVYI-------GKRSDG---------N-----P---------F----VGYRKVQG------------------Q-I----LGE-------D-----GMAVLPDDAKD-RL----ALQLAEFMNE-LSAFPVE-TAISAGVP---------------VTNLKNK----IL------LLSEAVEDQ------V---FPL-------LDE---SLRD----YLTLRFQS---Y-M---THPVY-T--RY------TPR---LIHGDLSPDHFLTNLNSRQT------PLTGII--DFGDAAISDPDYDYVYLLED--------C------------G--------------------EL-FTRQVMAYRGE-VD-LD-----THIRKVSLFVTFDQV-SYL-LE---------------------------------------------------
62 SP3 70.4414% 0 - C4 - - 1J7L KKA3_ENTFL A:[2-264] ----------------------------------------AKMRI-SPELKKLIEK-Y---------RCVKDTE--GMSPAKVYKLVG-E-N--------E-------NLYLKMTDSRYKGTT-----Y--------DV-EREKDM-ML-WLEG----K------LPVPK----------VLHF-------E--------------R-----HDGWS-----N----LLMSEADG------------------V-LCSEEYED-------E-----Q---------S-P-----EKIIELYAEC-IRLFHSI-DISDCPYTN--SL------D-SRLAELDYL----LN------NDLADVD--------C---ENW-------EED---TPFK----DPRELYDF---LKT---E---K-P--EE------ELV---FSHGDLGDSNIFVKD----G------KVSGFI--DLGRSGRADKWYDIAFCVRS--------I------------R--------------------EDIGEEQYVELFFD-LLGIK-----PDWEKIKYYILLDEL-F--------------------------------------------------------
56 HHSearch 69.6816% -21 - C4 - - 5IQI AACA_STAAU C:[9-257] ---------------------------------------ATNVKAMKYLIEHYFDN-F------KVDSIEIIGS--GYDS-VAYLVN---------------------NEYIFKTKF----ST-----NKK------KGFAKEKAI-YN-FLNTNLETN------VKIPN----------IEYS-------YISDE----------L-----S---------I----LGYKEIKG------------------T-F----LTP-------E-----IYSTMSEEEQN-LL----KRDIASFLRQ-MHGLDYT-DISECTID---NK----------QNVLEEY----IL-------LRETIY-------------ND-------LTDIEKDYIE----SFMERLNA---T-T-------V-F--EG------KKC---LCHNDFSCNHLLLDGN---N------RLTGII--DFGDSGIIDEYCDFIYLLED--------S------------EEEIG----------------TNFGEDILRMYGN-------------------------------------------------------------------------------------
55 HHSearch 69.6415% -34 - C4 - - 5IQC AACA_STAAU A:[6-257] ------------------------------------DDNATNVKAMKYLIEHYFDN-F------KVDSIEIIGS--GYDS-VAYLV--------------N-------NEYIFKTKF----ST-----NKK------KGYAKEKAI-YN-FLNTNLETN------VKIPN----------IEYS-------YISDE----------L-----S---------I----LGYKEIKG------------------T-F----LTP-------E-----IYSTMSEEEQN-LL----KRDIASFLRQ-MHGLDYT-DISECTIDN--KQ------NV--LEEYILL----RE------TIYN-----------------D-------LTD---IEKD----YIESFMER---L-N---ATT-V-F--EG------KKC---LCHNDFSCNHLLLDGN---N------RLTGII--DFGDSGIIDEYCDFIYLLED--------S------------EEEIG----------------TNFGEDILRMYGN-------------------------------------------------------------------------------------
27 Fugue 69.5214% -5 - C4 - - 3HAM ? A:[1-299] -----------------------------------------MVNLDAEIYEHLNKQ-I------KINELRYLSS--GDDS-DTFLC--------------N-------EQYVVKVPK----RD-----S--------VR-ISQKRE-FE-LYRF----LENCKLSYQIPA----------VVYQ-------S--------------D-----R---------F----NIMKYIKGERITYEQ-----------Y-H----KLS-------E-----K---------E-K-----DALAYDEATF-LKELHSI-EIDCSVSLF--SD------ALVNKKDKFLQDKKLLI------SILEKEQ--------L---LTD-------EML---EHIE----TIYENILN---N-A---V---L-F--KY------TPC---LVHNDFSANNMIFRN----N------RLFGVI--DFGDFNVGDPDNDFLCLLDC--------S------------T--------------------DDFGKEFGRKVLKYYQHKAP-----EVAERKAELNDVYWS-IDQ-IIYGYERKDREMLIKGVSELLQTQAEMFIF-----------------------
53 HHSearch 68.3217% -16 - C4 - - 5FUT CHKA_HUMAN A:[6-308] ---------------------------------------PRTRRRAYLWCKEFLPG-AWRGLREDEFHISVIRG--GLSN-MLFQCSL-P-DTTATLGDEP-------RKVLLRLYG------------GA------EAMVLESVM-FA-ILAER---S------LG-PK----------LYGI-------F--------------P-----Q---------G----RLEQFIPS------------------R-R----LDT-------E-----ELSL------P-DI----SAEIAEKMAT-FHGMKMP-FNKEPKWL---------------FGTMEKY----LK------EVLRIKFT-------EESRIKK-------LHK---LLSY----NLPLELENLRSL-L---E---S-T--PS------PVV---FCHNDCQEGNILLLE----GRENSEKQKLMLI--DFEYSSYNYRGFDIGNHFCE--------W------------MYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPA-FQ---------------------------------------------------------------------------------
52 HHSearch 67.7115% -28 - C4 - - 4DCA ? A:[25-272] ----------------------------------------LDAEIYEHLNK----Q-I------KINELRYLSS--GDDS-DTFLC--------------N-------EQYVVKVPK----RD-----SVR------ISQKRELEL-YR-FLENCKL-S------YQIPA----------VVYQ-------S--------------D-----R---------F----NIMKYIKG------------------E-R----ITY-------EQ----YHKLSEKEK-D-AL----AYDEATFLKE-LHSIEID-CSVSLFSDA--LV------NK--KDKFLQD----KK------LLISILE--------K---EQL-------LTD---EMLE----HIETIYEN---I-LSNAV---L-F--KY------TPC---LVHNDFSANNMIFRN----N------RLFGVI--DFGDFNVGDPDNDFLCLLDC--------S------------TDDFG----------------KEFGRKVLKYYQHK-AP---------------------------------------------------------------------------------
36 Fugue 67.2213% 18 * C4 * - 2QG7 - ? A:[50-458] YPITESNLRILEGEDRSEKAKELLKKYVSNVFENEKTLYIYCKYVMLHYGKDLVNP-N------EVDSLEFQII--NGTN-ILIKVKD-MSK--------Q-------AKYLIRLYG----PT-----DEII-----NR-EREKKI-SC-ILYN----K------NIAKK----------IYVF-------F--------------T-----N---------G----RIEEFMDG------------------Y-A----LSR-------EDIKN-P---------K-F-----QKLIAKNLKL-LHDIKLN-ENLYKELQV--TQKVPGTRPSFLWNTIWKY----FH------LLNEERKKICSFDAKA---NIL-------KLI---DFDV----LRDSIVEV---E-S---L---C-KRENS------PIV---LCHCDLLSSNIINTV----G------EGDSISFIDFEYSCPMERAYDIANHFNE--------YAGFNCDWDLTPSK--------------------EEEYHFIMHYLGTD-DEELI-----NQLIREIQPFYICSH-INWGLWSLLQGMHSFDFINYGMTRLTASCLPIFRSKV--------------------
47 HHSearch 65.3615% -32 - C4 - - 2PPQ - KHSE_AGRFC A:[5-265] --------------------------------------TDITEDELRNFLT-QYDV-G------SLTSYKGIAE-----N-SNFLLHT-T----------K-------DPLILTLYE----K------K--------NDLPFFLGL-MQ-HLAAK---G------LSCPL----------PLPR-------KDGELLGELSG----R-----P---------A----ALISFLEG------------------M-W----LRK-------P-----E---------A-KH----CREVGKALAA-MHLASEG-FEI-KRPNA--LS----------VDGWKVL----WD------KSEERA--------------DE-------VEK---GLRE----EIRPEIDY---L-A---AHW-P-K--DL------PAG---VIHADLFQDNVFFLG----D------ELSGLI--DFYFACNDLLAYDVSICLNA--------W------------CFEKDGAYN------------VTKGKALLEGYQSV-RPLSE-----AELEAL-------------------------------------------------------------------
54 HHSearch 63.6017% 5 - C4 - - 5FTG CHKA_HUMAN A:[6-308] ---------------------------------------PRTRRRAYLWCKEFLPG-AWRGLREDEFHISVIRG--GLSN-MLFQCSL-P-DTTATLGDEP-------RKVLLRLYG--------------------EAMVLESVM-FA-ILAER---S------LG-PK----------LYGI-------F--------------P-----Q---------G----RLEQFIPS------------------R-R----LDT-------E-----ELSL------P-DI----SAEIAEKMAT-FHGMKMP-FNKEPKWL---------------FGTMEKY----LK------EVLRIKFT-------EESRIKK-------LHK---LLSY----NLPLELENLRSL-L---E---S-T--PS------PVV---FCHNDCQEGNILLLE----GRENSEKQKLMLI--DFEYSSYNYRGFDIGNHFCE--------W------------MYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPA-FQ---------------------------------------------------------------------------------
50 HHSearch 62.3416% 8 - C4 - - 4R78 ? A:[20-253] ----------------------------------------HMEKIIKEKISSLLSQEE------EVLSVEQL-G--GMTN-QNYLAKT-T-N----------------KQYIVKFFG----KG-----TEKL-----INRQDEKYN-LE-LLKDL---G------LDVKN----------YLFD-------IE-------------A-----G---------I----KVNEYIES------------------AIT----LDS-------T-----S---------IKTK----FDKIAPILQT-IHTSAKE-LRGEFAP-F--EE----------IKKYESL----IE------EQIPY---------------AN--------YE---SVRN----AVFSLEKR---L-A-------D-L--GV------DRK---SCHIDLVPENFIESP----Q------GRLYLI--DWEYSSMNDPMWDLAALFLE--------S------------EFT------------------SQEEETFLSHYESD-QT---------------------------------------------------------------------------------
59 HHSearch 58.2716% -25 - C4 - - 6EF6 ? A:[28-303] -------------------------------------------VTIAQQALTHYDV-S------DNASLRLL-N--LSEN-ATYLVED-G----------E-------HQSILRVHR----QDYHQ--P--------HEIESELDW-LA-ALRTDS--D------VTVPT----------VVPA-------RDGRRVVTVDPADVPR-----H---------V----VHFEMVGG------------------A-E----PDE-------E-----SLT-------L-DD----FQTLGRITAS-LHEHSQR-WTRPAGF-G--RF----------SWDWEHC----LGDTPRWGRWQDAEG--------V----GA-------SET---ALLTRAQDLLHRKLEE---Y-G-------S-G--PD------RYG---LIHADLRLANLLVDS----STPQ---RTITVI--DFDDCGFGWYFYDFGTAVSF--------I------------EHDPRL---------------GEWQESWVAGYRSR-RELPA-----ADEAML-------------------------------------------------------------------
41 HHSearch 55.3018% -18 - C4 - - 5IGI ? A:[6-256] ---------------------------------------TADTSQLYALAAR-HGL-K------LHGPLTVNEL--GLDY-RIVIATV-D-D--------G-------RRWVLRIPR----RA-----EVS------AKVEPEARV-LA-MLKNRL--P------FAVPD----------WRVA-------NAELVA---------Y-----P---------MLEDSTA-VIQPG------------------S-S----TPD-------WVVPQDS---------E-VF----AESFATALAA-LHAVPIS-AAVDAGMLI--RT----------PTQARQK----VA------DDVDRVR--------R---EFV-------VND---KRLH----RWQRWLDD---D-S-------S-W--PD------FSV---VVHGDLYVGHVLIDNT---E------RVSGMI--DWSEARVDDPAIDMAAHLMV--------F------------G--------------------EEGLAKLLLTYEAA-GG---------------------------------------------------------------------------------