@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B5HLT6_9ACTN: (2019-01-26 )
MCINFLVCASLSMFRTSVSGARVPIGAWPDRGGEVRDAVLSVFRRNEYMREIDTGARVASPGTGCDGLVGTCPVDKPVDSVAVGVLARFLAQLTLVRKEALPALPAEWSRNERDSRAYLDTLVRHAKRRMLDPNWTAIGGLFAVLGVPGDRLVRFAEQVPAMSRRPYGLLLTNLARDNVTILEGPKLAEAGLDWTSASYGDPLHGLAGHVVRMRYPQDQVNEVVQAWACEMRRIRPPAVSGLDRDLPYYLDFERIHAAYDDVIRAARSLGDSIENLALLAAASDIGTALKRAAGLLGMSEVPPEKEIADALFRWQAARLVRAAERVPDSLFRWRCDDRVPERDDFPSDLVRRALAVEGVAPADRVFRGTAHLNTVVQLENYPDPVVVRRETAAAPRREQGLLPEHAVLQVIERSGVQVRAPRILALGYDDRRRHVAIHTYEGPGGRSPQHPVDGLLPAEADELVDELAALAEVDHSSLPSNEPEGGFYRWLAERLADFVAALPDATLRAADQRGLPDGDLLRQILGRYKVSDRAPVLLHGDLNPWNLVRAGRQGGLTIIDWEMGMIGDPLYDLVRHLHLTPTRTEMRVRMFDRWSKKLPAECVVGWEEDWRVYRYIEQIRSAYVDLDRMTTGAALSTPNVRRAVDAYEMTLSAATGSLGLRRRVVPKVPASLKVS

Atome Classification :

(21 SA) ------------------------------------------------------------------------------------------------------------------------.....-------....10......-.----.20...----.------..-----.----.30..---.-.....40....-....50....-----------------..-----..-60.-------....----------...70......--..80........----90........100..------.....110.......120.......130-------.--------.------.....140.........150.......160-.........170-......--.---.180-----........190-----....-----...200.......210.......---220.......230......-----.240----.......250.......----.260.......270....-------...280.......290.-------------.....-.300.......310.......320----.........330...--....340.....---..350.....-.--.360-.-.......370.......---------380--------........390...---....400.......--410.-.---.....420.......----------430.........440.......450-----------.......---..460.....---..470..-----------...--..480--..----.--------..-...490--........500----------.---....------.-...510.......520.......-530.---...----.....540----........550--.-......560...-....570-..---..---...-.-.580.----------------.------------------..--------------.-....590...------....600-------......-.610---------------.........620..------------.....630..---------..-...----640.......650.......660..----.....670...------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ------------------------------------------------------------------------------------------------------------------------MCINF-------LVCASLSMFRTS-V----SGARVP----I------GA-----W----PDRGG---E-VRDAVLSVFRR-NEYMREIDTG-----------------AR-----VA-SPG-------TGCD----------GLVGTCPVDKP--VDSVAVGVLARF----LAQLTLVRKEALPAL------PAEWSRNERDSRAYLDTLVRHAKRRMLD-------P--------N------WTAIGG--LFAVLGVPGDRLVRFAEQVP---AMSRRPYGLLL--TNLARD--N---VTI------LEGPKLAEAGL-----DWTS-----ASYGDPLHGLAGHVVRMRYPQDQ---VNEVVQAWACEMRRIRPPA-----VSGL----DRDLPYYLD-FERIHAA----YDDVIRAARSLGDSIENL-------ALLAAASDIGTALKRAA-------------GLLGM-SEVPPEKEIADALFRWQAARLV------RAAERVPDSLFRWRC--DDRVPERDDFPS---DLVRRALAVE-G--VA-P-A-DRVFRGTAHLNTVVQLE---------NY---------PDPVVVRRETAAAP---RREQGLLPEHAVLQ--VIER-S---GVQVRAPRILALGYD----------D--RRRHVAIHTYEGPGGRSPQH-------------PVDGLLP---AEADELVDEL---AALAEVD-----------HSS--LPSN---EP----E--------GG-FYRWL---AERLADFVA------------A---LPDA------T-LRAADQRGLPDGDLLRQILGRYK-V--S---DRA----PVLLHGD-----LNPWNLVRAGR--Q-GGLTIIDWEMGM-IGDPL---YD---LV---RHL-H-LT--P----------------T------------------RT--------------E-MRVRMFDRWS------KKLPAEC-------VVGWEE-DW-----------------RVYRYIEQIRSAYV------------DLDRMTTGAA---------LS-TPN----VRRAVDAYEMTLSAATGSLGLRRRV----VPKVPASLKVS------------------------------------------------------------------------------------------------------------------------
62 Fugue 67.6319% 34 - C5 - - 4PQG ? A:[6-511] --------------------------------------------------------------------------------------------------------------------------HHH-------MTIYNINL---------------G----I------G------W----ASSGV---EYAQAYRAGVFRKLNLSSKFIFTD-----------------MI-----LA-DN----------IQ----------HLTANIGFD-----DNQVIWLYNHFTDIKIAPTSVTVDDVLAYF------GGEESHREKNGKVLRVFF---------------------------------FDQDKF--VTCYLVDENKDLVQHAEYVF---KG-----------NLIRKD--Y---FS-----------------Y-----TRYC-----SEYFAPKDNVAVLYQRTFYNEDG---T----PVYDILMNQ------------------GKEEVYHFK-DKIFYGK----QAFVRAFMKSLNLNKSDL-------VILDRETGIGQVVFEEA-----------------------------------QTAHLA------VVV-----------H--AEHYSENATNED---YILWNNYYDY-Q--FT-N-A-DKV-----------------------------------DFFIV------ST---DRQNEVLQEQFAKY--TQHQ-P---KIVT-----IPVGSI----------D--SLT-------DSSQGRKPF-----------------SLIT---ASR------------LAKEK-----------H------------------------------IDWL---VKAVIEAHK------------E---LPEL------T-FDIYGSGG--EDSLLREIIANHQ-A--E---DYI----QLKGHAE-----LSQ---------------IYSQYE------------------------V-Y-LT--A----------------S------------------TS--------------EGFGLTLMEAIG------SGLP----------LIGFDV-PY-----------------GNQTFIEDGQNGYLIPSSSDHVEDQIKQAYAAKICQ---------LY-QEN----RLEAMRAYSYQIAEGFLTKEILEKW----KKTVEEVLHD-------------------------------------------------------------------------------------------------------------------------
53 Fugue 67.3416% -77 * C9 * - 5UFL - CIP2A_HUMAN A:[5-561] --------------------------------------------------------------------------------------------------------------------------------------TACLKSLLLT-V----SQYKA-------------------------------------------NA-TQLLRHLEVI-----------------SR-----LF-TS------------------------------NQI--LTSECLSCLVEL----LEDPSASLILSIIGL------LSQLAVDIETRDCLQNTL------------------------------------NSV--LAGVVCRTDSVFLQCIQLLQ---KLT---YN-----VKIFYS--G---ANI---------DELITFLI-----DHIQ-----SELKMPCLGLLANLCRH----------NLSVQTHIKTLS------------NSF----YRTLITLLA-HSSLTVV----VF-ALSILSSLTLNEEVG-------EKLFHARNIHQTFQLIF-------------NILIN-GDGTLTRKYSVDLLMDLLKN-----------PKIADYLTRY-----------EHFSS---CLHQVLGLLN-GKDPD-S-S-SKVLELLLAFCSVTQLR---------HM---------LTQMMFESHT----------KCLEPTVALLR--WLSQ-PLDGNCSVLALELFKEIFE----------D--VI--------DAANCSSADR-------------FVTLLLP---TILDQL---------------------------Q--FTEQ---NL----D--------EA-LTRKK---CERIAKAIE------------V---LLTL------C-----------GDDTLKMHIAKIL-T--T---VKC----TTLIEQQ-----FTYGKIDL--G--F-GTKVADSELCKL-AADVI---LK---TL---DLI-NKLK--P----------------L------------------VP--------------G-MEVSFYKILQ------D-------------------------------------------------------------------PRLITPLA---------FALTSD----NREQVQSGLRILLEAAPLPDFPALV----LGESIAANNAYRQQE--------------------------------------------------------------------------------------------------------------------
51 Fugue 58.0614% -65 - C10 - - 1ZYL - SRKA_ECOLI A:[4-328] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SAFTFQTLHP---DTIMDALFEH-G--IR-V-D-SGLTPLNSYENRVYQFQ---------DE---------DRRRFVVKFYRPER---WTADQILEEHQFAL--QLVN-D---EVPVAAPVAFNGQTL----------L--NHQGFYFAVFPSVGGRQFEA-------------DN----I---DQMEAVGRYL---GRMHQTG-----------RKQ--LFIH---RP----T--------IG-LNEYL---IEPRKLFED------------A---TLIP------S-GLKAAFLKATDE--LIAAVTAHW-R--E---DFT----VLRLHGD-----CHAGNILW-----R-DGPMFVDLDDAR-NGPAV---QD---LW---MLLNG-DK--A----------------E------------------QR--------------M-QLETIIEAYE------EFSEF----------------DT-----------------AEIGLIEPLRAMRL------------VYYLAWLMRR---------WA-DPA----FPKNFPWLTGEDYWLRQTATFIEQA----KVLQEPPLQLTPMY---------------------------------------------------------------------------------------------------------------------
59 Fugue 53.4617% 10 - C8 - - 4R8A - FAN1_PSEAE A:[16-553] ------------------------------------------------------------------------------------------------------------------LPEPFYYLHNF-------RAVLAWIGERYA-DLLD-DQERAF----I------AA-----F----AELPE---A-SQALLVRMVMR-KG---TLFRE-----------------GK-----LA-YAE-------IG-D----------TRAAVQPLLALGWVDAQPTLELAQL----FGLLK--KDELSQLF------RDHLGRANLRKDALLERLQPLFPEARRL-------A--------E------WQAD-----------FAEPVYEL--RCM---ALCDRLRLMYF--GNLWQDWSE---FVL------ADLGIYRYESV-----EFSA-----DSRGFRL-------------RAD---VDAYLHLFDCRQRFDLGEP-----LEEL----LAGLP---------GEP----YAN----PWLEGRRVKLL-------FQFAQHCEKQRDFDLAQ-------------RLYRQ-SSHPG--------ARLRAIRSL------ERGERFAEAHALARE--ASCAPESDAERQ---GLARLLPRLQ-G--KL-G-L-PRQARAAAPEIDRLDLC---------LA---------FPSEPCSVEWAVRE---HLE----EPGCAVH--YVEN-G---LINSLFGLLCWEAIF----------A--AIPGAFFHPFHSAPADLHSA-------------DFRQRRA---ALFEACLGRLEDGSYRDAIR-----------CRY--RDKF---GL----Q--------SP-FVYWELLGEELLEQALD------------C---LPAA------H-LRAWFERLLED---------------------------------------------IPGNR--A-G----------------L---PD---LI---QFW-------P----------------A------------------QR--------------R-YRMVEVKGPG------DRLQ--------------DN-QL-----------------RWLQFCRE------------------------------------------------------REMPVAVCYV-----------------------------------------------------------------------------------------------------------------------------------------------
57 Fugue 52.5016% -20 - C9 - - 4L9M GRP1_HUMAN A:[5-545] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------LG-----H----LAKGA---S-LDDLIDSCIQS-------FDAD-----------------GN-----LC-RSN-------QLLQ----------VMLTMHRI----------VISSAEL----LQKVITLYKDALA----------------KNSPGLCLKICYFV-RYWIT-------E--------F------W----V--MFKMDASLTDTMEEFQELVK---AKGEELHCRLIDTTQINAR--D---WSR------KLTQKKRKVSL-----LFDH-----L----EPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTM-----ERSI----ALCNGISQW-VQLMVLS----RPTPQLRAEVFIKFIQVA-------QKLHQLQNFNTLMAVIG-------------GL-CH-SSISRLKETSSHVPHEINKVLG------EMTELLSSSRNYDNY--RRAYGECTDFKIPILGVHLKDLISL-Y--EA-M-P-DYLEDGKVNVHKLLALY---------NH---------ISELVQLQEVAPP---------LEANKDLVH--LLTL-SL--DLYYTEDEIYELSYA----------R--EPRPVVV---DWASGVSPK--------------PDPKTIS---KHVQRMVD-----SVFKNYD-----------H------------D----Q--------DG-YIS-----QEEFEKIAA------------S---FPFS------F-CVMDKDRE-------------------------------------------------------------------GL-I--------------------------------------------S------------------RD--------------E-ITAYFMRASS------IY--SKL-------GLGFPH-NF-----------------QETTYL---KPTFC------------DN---CAGFL---------WG-VIK----QGYRCKDCGMNCHKQCKDL-----V----VFECKK-----------------------------------------------------------------------------------------------------------------------------
32 HHSearch 51.5614% -91 - C10 - - 3DXQ - ? B:[27-263] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GGLTNLVFRA----------------------GDLCLRIP------------NRANEAVAAR--EAAK-A---GV--S-PEVLHVDPA---------------TGVMVTRYIAGA-QTMSP-------------EKFKTRP---GSPARAGEAF---RKLHGSG-----------AVF--PFRF---EL----F--------AM-IDDYL---K-VLSTKNV------------T---LPAG------Y-HDV--------VREAGGVRSALA-A--H---PLP----LAACHCD-----PLCENFLDTG-----ERMWIVDWEYSG-MNDPL---WD---LG---DLS-V-EG--K----------------F------------------NA--------------N-QDEELMRAYF------GGEAR----------PAERG-RV-----------------VIYKAMCDLLWTLW------------GLIQLAN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
56 Fugue 51.5316% -19 * C8 * - 5E75 SUSD_BACO1 A:[13-519] ---------------------------------------------------------------------------------------------------------------------------------------FYTSDEALE-A----ATAPLY----N------RA-----W----FDYNQ---R-SIVPIGS--GR-ANDMYSPWNY-----------------PQ-----FV-TFQ-------VT----------------------A--LDENLSGAWSGF----YSVVTMANSVINAVE------TQTQSV----------SEAAKTKAIAEA-------R--------L------MRACAY--FYML-----------------------RIWGPVI----LIED--N---QKL------VD---------------------------NPVRPLNREEDVFQFIIND---LNYAVDNLSEQSDK-----------------------------GRATSW----AAKGILAKVYLARSGWNN-------GGTRDEGDLELARQYAS-------------DVCEN-SGLDLMTNYEDLFKYKNNNN------------QESLLAMQWVP--LGEWYECNTLLS---DLAFSTEVTG-G--VN-C-W-SS-YNGSIDMLQQYELA---------D----------------------TL---RRNATFFTKGSYYSYICIKD-G---GYTYKGTA-------------------------SPIKKGVPGG------------------PDDDN------------------------D-----------GKV--KQMN---SP----L--------NT-YILRL---ADVYLTYAE------------A---CLGN------N-STLSDGRGL---YFFNRVRERAK-I--N---KKS----SI-------------------TL--D-DIIRERRVEFGM-EYSNW---YD---MV---TWF-R-YL--P----------------D------------------KM--------------L-NYFNNQWRGY------RT---DA-------IIKDED-GK-----------------LHFGKYDTDGTTFL------------EGPEYYTAPE---------F--TIN----IEAEDIFLPYPESDVIQNPLLNEPP----VPYTFNE----------------------------------------------------------------------------------------------------------------------------
30 HHSearch 50.2517% -9 - C10 - - 3DXP ? A:[20-334] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RFDT---EALEAWMRQHVE--GFAGPLSVEQFK-G-QSNPTFKLV---------TP---------GQTYVMRAKPG----------AIEREYRVMD--ALAG-T---DV--PVAKMYALCED----------ESVIGRAFYIMEFVSGR--VLWDQSLPG--------MSPAERT---AIYDEMNRVI---AAMHTVD-----------YQA--IGLG----D----Y--------GK-PGNYF---QRQIERWTK------------Q---YKLS------E-T-----ESIPAMDSLMDWLPQHI-PQED---ADL----TSIVHGD-----YRLDNLMFHPTE-P-RVLAVLDWELST-LGHPM---GD---FG---YHC-M-SW--HIAPGQFRGIAGLDHAAL------------------GI--------------P-DEASYRKLYE------QRTGRPI-----------TG-DW-----------------NFYLAFSMFRIAGILQG---------IMKRVVDGTA---------SS-A----------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 HHSearch 48.4813% -25 - C10 - - 4R78 ? A:[47-302] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GMTNQNYLAK---------TT---------NKQYIVKFFGKGTE----KLINRQDEKYNLE--LLKD-L---GL--DVKNYLFDI----------------EAGIKVNEYIESA-ITLD----------------STSIK---TKFDKIAPIL---QTIHTSA-----------KEL--RGEF---A-----P--------FE-EIKKY---ESLIEEQ------------------IPYAN-----Y-ESV--------RNAVFSLEKRLA-D--L---GVD----RKSCHID-----LVPENFIESPQ----GRLYLIDWEYSS-MNDPM---WD---LA---ALF-L-ES--E----------------F------------------TS--------------Q-EEETFLSHYE------SDQTP-----------VSHE-KI-----------------AIYKILQDTIWSLW------------TVYKEEQGE--------------DF----GDYGVNRYQRAVKGLAS-----------------------------------------------------------------------------------------------------------------------------------------------
47 Fugue 47.6715% -18 - C10 - - 3HAM ? A:[1-299] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MVNLDA---EIYEHLNKQI-K--IN-E-L-RYLSSGDD--SDTFLCN---------------------EQYVVKVPKRD-----SVRISQKREFELYR--FLEN-C---KLSYQIPAVVYQS-----------------DRFNIMKYI-KGERITYE-------------QYHKLSE---KEKDALAYDE---ATFLKEL-----------HSI--EIDC---SV----S--------LF-SDALVN--KKDKFLQDK------------K---LLIS------I-LEKEQLLTDEMLEHIETIYENIL-N--N---AVLFKYTPCLVHND-----FSANNMIFRNN--R-LF-GVIDFGDFN-VGDPD---ND---FL---CLLDC-ST--D----------------D------------------FG--------------K-EFGRKVLKYY------QHKAPEV-------AERKAE-LN-----------------DVYWSIDQIIYGYE------------RKDREMLIKG---------VS-ELL----QTQAEMFIF-------------------------------------------------------------------------------------------------------------------------------------------------------
26 HHSearch 47.3813% -25 - C10 - - 4R7B - ? A:[47-302] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GMTNQNYLAK---------TT---------NKQYIVKFFGKGTE----KLINRQDEKYNLE--LLKD-L---GL--DVKNYLFDI----------------EAGIKVNEYIESA-ITLD----------------STSIK---TKFDKIAPIL---QTIHTSA-----------KEL--RGEF---A-----P--------FE-EIKKY---ESLIEEQ------------------IPYAN-----Y-ESV--------RNAVFSLEKRLA-D--L---GVD----RKSCHID-----LVPENFIESPQ----GRLYLIDWEYSS-MNDPM---WD---LA---ALF-L-ES--E----------------F------------------TS--------------Q-EEETFLSHYE------SDQTP-----------VSHE-KI-----------------AIYKILQDTIWSLW------------TVYKEEQGE--------------DF----GDYGVNRYQRAVKGLAS-----------------------------------------------------------------------------------------------------------------------------------------------
41 HHSearch 47.3616% 16 - C10 - - 3ATT Y3168_MYCTU A:[31-319] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TGMSSETIILT---------ARWQQDGRSI-QQKLVARVAPAAEDVPVFPTYRLDHQFEVIR--LVGELT---DV--PVPRVRWIETT----------GDVLGTPFFLMDYVEGV--VPPDVMPYTFGDNWFADAPAERQR---QLQDATVAAL---ATLHSIP-----------NAQ--NTFSFLT---------------DT-TLHRH---FNWVRSWYD------------F---AVEG------I-------GRSPLLERTFEWLQSHW-P--DDAAARE----PVLLWGD-----ARVGNVLYRDF----QPVAVLDWEMVA-LGPRE---LD---VA---WMI-F-AH--R----------------V------------------FQELAGLATLPGLPEVM-REDDVRATYQ------ALTGVE------------LG-DL-----------------HWFYVYSGVMWACV---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
66 SP3 47.2411% 4 - C5 - - 1LLW GLTS_SYNY3 A:[439-1239] DAQTVLQQQAAFGYTAEDVEMVVVPMASQGKEPTFCMGDDTPLAVLSHKPRLLYDYFKQRFAQVTNPPIDPLRENLVMSLAMFLGKRGNLLEPKAEKLRSPLVNEVELQAIKTGQLQVAEVSTLYDLDGVNSLEDALTNLVKTA-IATVQAGAEIL----VLTDRPNGA-----I----LTENQ---S-FIPPLLAVGAV-HHHLIR--AG-----------------LRLKASLIV-DTA-------QCWSTHHFACLVGYGASAICP--------YLALESVRQW----W------LDEKTQKL------MENGRLDRIDLPTALKNYRQSVEAGLFKILSKMGIS--------L------LASYHGAQIFEAIGLGAELVEYA---FA---GTTSRVGGLTI--ADVAGE--V---MVFHGMAFPEMAKKLENFGFVNYRPGGEY-----HMNSPEMSKSLHKAVAAYY---------DHYELYRQYLKDRPVTA-----LRDLLDFNADQPAISLEEVESVESI----VKRFCTGGMSLG----------------ALSREAHETLAIAM-------------NRLGA-KSNSG-----------EGGEDV------VRYLTLDDVDSEGNS--PTLPHLHG-------------LQNG-D--TA-N-S-AIKQIASGRFGVTPEYL---------MS---------GKQLEIKMAQGAK----PGEGGQLPGKKVSE--YIAM-L----RRSK------------------------------------PGVTLIS-------------PPPHHDI---YSIEDLAQLI---YDLHQIN-----------PEAQVSVKL---VA----E--------IG-IGTIA---AGVAKANADIIQISGHDGGTGA---SPLS------S-IKHAGSPWELGVTEVHRVLMENQ-L--R---DRV----LLRADGG-----LK------TGW--D-VVMAAL-------MG------AEEYGFG---SIA-M-IA--E----------------G------------------CI--------------M-ARVCHTNNCP------VGVATQQ-------ERLRQRFKG-----------------VPGQVVNFFYFIAE------------EVRSLLAHLG---------YR-SLDDIIGRTDLLKVRSDVQLSKTQNLTLDC-L----LNLPDTKQNRQWLNHEP------------------------------------------------------------------------------------------------------------------
70 SP3 46.4710% 23 - C2 - - 1KBL - PPDK_CLOSY A:[1-872] -----------------------------------------------------------------------------------------------------------AKWVYKFEEGNASM-RNL-------LGGKGCNLAEMT-I----LGMPIPQGFTV------TTEACTEY----YNSGK---Q-ITQEIQDQIFE-AITWLEELNGKKFGDTEDPLLVSVRSGAR-----AS-MPGMMDTILNLGLNDVAVE-----GFAKKTGNPRF--AYDSYRRFIQMY----SDVVMEVPKSHFEKIIDAMKEEKGVHFDTDLTADDLKELAEKFKAVYKEAMNGEEFP--------QEPKDQLMGAVKA--VFRSWDNPRAIVYRRMNDIPGDWGTAVNVQTMVF--GNKGET--SGTGVAF------TRNPSTGEKGI-----YGEY-----LINAQG-EDVVA-GVRTPQPITQ---LENDMPDCYKQFMDLAMKL-----EKHF----RDMQDMEFT-IEEGK-L----Y---FLQTRNGKRT-APA-------ALQIACDLVDEGMITEE-------------EAVVR-IE-------AKSLDQLLHPTFN------PAALKAGEVIGSALPASPGAAAGKVYFTA---DEAKAAHEKG-E--RV------ILVRLETSPEDIEGMH---------AA----------EGILT--VRGGMT---SHAAVVARGMGTCC--VSGC-G---EIKINEEAKTFELGG----------H--TFAEGDYISLDGSTGKIYKG-------------DIETQEASVSGSFERIMVWA---DKFRTLKVRTNADTPEDTLNA--VKLG---AE----GIGLCRTEHMF-FEADR---IMKIRKMIL------------S---DSVE------A-REEALNELIPFQKGDFKAMYKAL----E---GRP----MTVRYLD-----PPLHEFVPHTE--E-EQA-----ELAKNMGLTL---AE---VK---AKV-D-EL--H----------------E------------------FN--------------P-MMGHRGCRLA------VTYP---------------E--------------------IAKMQTRAVMEAAI------------EVKEETGIDIVPEIMIPLVGE-KKE----LKFVKDVVVEVAEQVKKEKGSDMQYHIGTMIEIPRAALTADAIAEEAEFFSFGTNDLTQMTFGFSRDDAGKFLDSYYKAKIYESDPFARLDQTGVGQLVEMAVKKGRQTRPGLKCGICGEHGGDPSSVEFCHKVGLNYVSCSPFRVPIARLAAAQAALNN
48 Fugue 46.3213% -40 - C10 - - 1J7L KKA3_ENTFL A:[2-264] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AK---MRISPELKKL-I--EK-Y-R-CVKDTEGMSPAKVYKLV---------GE---------NENLYLKMTDSRYK---GTTYDVEREKDMML--WLEG-------KLPVPKVLHFERH----------D--GWSNLLMSEADGVLCSEEYE-------------D-EQSPE---KIIELYAECI---RLFHSID-----------ISD--CPYT---NS----L--------DS-RLAEL---DYLLNNDLA------------D---VDCE------N-WE--EDTPFKDPRELYDFLKTEK-P--E---EE-----LVFSHGD-----LGDSNIFVKDG----KVSGFIDLGRSG-RADKW---YD---IAFCVRSI-R-ED--I----------------G------------------EE--------------Q-YVELFFDLLG------IKPD--------------WE-KI-----------------KYYILLDELF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
42 HHSearch 46.1616% 16 - C10 - - 3ATS Y3168_MYCTU A:[31-319] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TGMSSETIILT---------ARWQQDGRSI-QQKLVARVAPAAEDVPVFPTYRLDHQFEVIR--LVGELT---DV--PVPRVRWIETT----------GDVLGTPFFLMDYVEGV--VPPDVMPYTFGDNWFADAPAERQR---QLQDATVAAL---ATLHSIP-----------NAQ--NTFSFLT---------------DT-TLHRH---FNWVRSWYD------------F---AVEG------I-------GRSPLLERTFEWLQSHW-P--DDAAARE----PVLLWGD-----ARVGNVLYRDF----QPVAVLDWEMVA-LGPRE---LD---VA---WMI-F-AH--R----------------V------------------FQELAGLATLPGLPEVM-REDDVRATYQ------ALTGVE------------LG-DL-----------------HWFYVYSGVMWACV---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
33 HHSearch 45.7614% -87 - C- - - 3DXQ - ? A:[27-263] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GGLTNLVFRA----------------------GDLCLRIPGK--------YINRANEAVAAR--EAAK-A---GV--S-PEVLHVDPA---------------TGVMVTRYIAGA-QTMSP-------------EKFKTRP---GSPARAGEAF---RKLHGSG-----------AVF--PFRF---EL----F--------AM-IDDYL---K-VLS--NV------------T---LPAG------Y-HDV--------VREAGGVRSALA-A--H---PLP----LAACHCD-----PLCENFLDTG-----ERMWIVDWEYSG-MNDPL---WD---LG---DLS-V-EG--K----------------F------------------NA--------------N-QDEELMRAYF------GGEAR----------PAERG-RV-----------------VIYKAMCDLLWTLW------------GLIQLAN--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
71 SP3 45.4912% 16 - C5 - - 1KWG BGAL_THETH A:[1-644] ---------------------------------------------------------------------------------------------------------------------MLGVCYYPEHWPKE-RWKEDARRMREAGL----SHVRIG----E------FA-----WALLEPEPGRLEWG-WLDEAIATLA---------AEG-----------------LK-----VVLGTP-------TA----------------TPP--------KWLVDRYPEI----LPVDREGRRRRFGGR------RHYCFSSPVYREEARRIVTLLAERYGGL-------EAVAGFQTDN------EYGCHD--TVRCYC--PRCQEAFRGWLE---ARYGT-----I--EALNEA--W---GTA------FWSQRYR---------SFAEVELPHLTVAEPNPSHLLDYYR--FASDQ---VRAFNRLQVEILRAHAPGKFVTHNFMGF----FTDLDAFAL-AQDLDFASWDSYPLGFTDLMPLPPEEKLRYARTGHPDVAAFHHDLYRGVGRGRFWVMEQQPGPVNWAPHNP-SPAPGMVRLWTWEALAHGAEVVSYFRWRQAPFAQEQMHAGLHR--PDSAPDQGFFEA---KRVAEELAAL-A--LP-P-V-AQA--------PVALVF---------DY---------EAAWIYEVQPQG-----AEWSYLGLVYLFYS--ALRR-L---GLDVDVVPP-----G----------A--SLRGYAFAVV---------P-------------SLPIVRE---EALEAFRE-----------A-----------EGP--VLFG---PR----S--------GS-KTETF---QIPKELPPG------------P---LQAL------LPLKVVRVESLP---------------------PGL----LEVAEGALGRFPLGLWREWVEAP--LKPLLTFQD-------GKGALYREG---RY---LYL-A-AW--P----------------S------------------PE--------------L-AGRLLSALAAEAGLKVLSLPEGL-------RLRRRG-TW-----------------VFAFNYGP----------------------------------------------------EAVEAPASEGARFLLGSRRV----GPY---DLAVWEE----------------------------------------------------------------------------------------------------------------------
39 HHSearch 45.4912% -20 - C10 - - 1NW1 - CKA2_CAEEL B:[80-425] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RIK-GGMSNMLFLCR---------LSEVYPPIRNEPNKVLLRVYFNPE-----TESHLVAESVIFT--LLSE-R---HL--G-PKLYGIF-----------------SGGRLEEYIPSR--PLSC-------------H-EISLA---HMSTKIAKRV---AKVHQLE-----------VPI--WKEP---DY----L--------CEALQRWL---KQ-LTGTVD------------AEHRFDLP------E-ECGVSSVNCLDLARELEFLRAHISL--S---KSP----VTFCHND-----LQEGNILLPK------RLVLIDFEYAS-YNYRA---FD---FA---NHF-I-EW--T----------------IDYDIDEAPFYKIQTENFPEN--------------D-QMLEFFLNYL------REQGNTRENELYKKSEDLVQ-ET-----------------LPFVPVSHFFWGVW------------GLLQVELSPV----------G-FGF----ADYGRDRLSLYFKHKQLLKNL-------------------------------------------------------------------------------------------------------------------------------------------
65 SP3 43.925% 10 - C10 - - 1NW1 - CKA2_CAEEL A:[32-426] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GMKELL-------------STMDLDTDANTIPELKERAHMLCARFLG------GAWKTVPLEHLRISR--IK----------------------------------------GGMSNMLFLCRLSEVYPPIRNE---------PNKVLLRVYFNPE-----TESHLVAESVIFT--LLSE-R---HL---GPKLYGIFSG-------------------GRLEEYIPSRPL-S-------------CHEISLA---HMSTKIAKRV---AKVHQLE----------------VPIW---KE----P--------DY-LCEAL---QRWLKQLTG------------T---VDAEHRFDLPE-ECGVSSVNCLDLARELEFLRAHI-S--LS--KSP----VTFCHND-----LQEGNILLPKR--L-VLI---DFEYAS-YNYRA---FD---FA---NHF-I-EWTID----------------Y------------------DI--------------D-EAPFYKIQTE------NFPENDQ-------MLEFFL-NYLREQGNTRENELYKKSEDLVQETLPFVPVSH------------FFWGVWGLLQ---------VE-LSP----VGFGFADYGRDRLSLYFK--HKQLL----K-----NLA--------------------------------------------------------------------------------------------------------------------------
44 HHSearch 37.3217% 8 - C10 - - 6EF6 ? A:[51-294] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LSENATYLVE---------DG---------EHQSILRVHRQDYH----QPHEIESELDWLA--ALRTDS---DV--TVPTVVPARDGRRVVTVDPAD---VPRHVVHFEMVGGA--EPDE---------------ESLTL---DDFQTLGRIT---ASLHEHS-----------QRW--TRPAGF-GRFSWDW--------EH-CLGDT---PR-WGRWQD------------AEG-VGAS------E-TALLT----RAQDLLHRKLEEYG-S--G---PDR----YGLIHAD-----LRLANLLVDSSTPQ-RTITVIDFDDCG-FGWYF---YD---FG---TAV-S-FI--E----------------HDPR---------------LG--------------E-WQESWVAGYR------SRRE-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------