@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B6BH72_SULGG: (2019-01-26 )
MGVKTQLSLHELNQLFPSYGFTEIKPTISGIIDTTYIIHNETTGYILKRYERDITRKIELDIKLLNELKSVGLNVPACLDSNYGWYIYEKLEGKQPTNTKSYHIQALGRFLAKMHSQTSKMRCDSNRIIEDEVTQSLKYVKENFFAYYKRFEFLKNFTHKHEAIIHGDIFKDNTIFNGRKIGVIDFIDSSCGTFAYDVAVTLVGFDARERHDYYINLFLKNYNQHAPKKLSKKVVKEKMKFAANFFALKRVHEYKNTSRAKELLK

Atome Classification :

(21 SA) -------------------.........10........---20----.--.----.......30....-..-..40-........50------.---..--.---.-..---..60........---70.-.-.---------......80---------.------------.-------...----....90---------.-----------...---------..------..------.-------------100--...-----------------.....-.110...------------------.----------.-..120...-.-------------------------------------.-----.---.130----..-.-------.----.---...140------------.----------.-------.--.-------------------.----------....------------150---.-----------.----.-.----.-------.-.--..160--.--..-.---------....--------.170....-.--------.--.-----180-........190.......200...---------.-----------------....-----------210-.--...-----------....-.220....------.-..230----..-.....-240.......250--.-...-------------.....260...-------------------------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -------------------MGVKTQLSLHELNQLFPSY---G-----F--T----EIKPTISGIIDTT-YI-IHNE-TTGYILKRY-------E---RD--I---T-RK---IELDIKLLNELK---S-V-G-L---------NVPACLD----------S------------N-------YGW----YIYEK----------L-----------EGK---------QP------TN------T-------------K----SYH-----------------IQALG-RFLAKMH------------------S----------Q-TSKMRCDS-N-------------------------------------R-----I---IE-D----EV-T-------Q----S---LKYV--------------K----------E-------N--F-------------------F----------AYYK------------R-----F-----------E----F-L----K-------N-F--THK----H--EA-I---------IHGD--------IFKDNTIF-N--------G--R-----K-I-GVIDFIDSSCGTFAYDVAV-TLVG---------F-----------------DARE-----------R---H--DYY-----------INLF-LKNYNQHA------P-KKLSK----KV-VKEKM-KFAANFFALKR----V-HEY-------------KNTSRAKELLK-------------------------------------------
21 HHSearch 77.8923% 16 - C3 - - 2PPQ - KHSE_AGRFC A:[5-281] -----------------------TDITEDELRNFLTQY---D-----V--GSLT-SYKGIAE---NSN-FL-LHTT-KDPLILTLY-------E---K-------K-ND---LPFFLGLMQHLA---A-K-G-L---------SCPLPLPRK--------DGELLGELS----G-------RPA----ALISF----------L-----------EGM---------WL------RK------P-------------E----AKH-----------------CREVG-KALAAMH------------------L----------A-SEGFEIK----------------------------------------R-----P---NA-L----SV-D-------G----W---KVLW--------------D----------KSEERADEV--E-------------------K----------GLRE------------E-----I-----------RPEIDY-L----A-------AHWP-KDL----P--AG-V---------IHAD--------LFQDNVFF-L--------G--DE----L-S-GLIDFYFACNDLLAYDVSI-CLNA---------W-----------------CFEK-----------DGAYN--VTK-----------GKAL-LEGYQSVR---------PLSEAEL-EA-LPLLS-RGSALRFFLTR----L-----------------------------------------------------------------------
25 HHSearch 73.0017% 10 - C3 - - 6EF6 ? A:[27-313] --------------------------DVTIAQQALTHY---D-----V--SDNA-SLRLL-NLSENAT-YL-VEDG-EHQSILRVH-------R---QD--YHQ-P-HE---IESELDWLAALR---TDS-D-V---------TVPTVVPAR--------DGRRVVTVDPADVP-------RHV----VHFEM----------V-----------GGA---------EP------DEES----L-------------T----LDD-----------------FQTLG-RITASLH------------------E----------H-SQRWTRPAGF-------------------------------------G-----R---FS-W----DW-EHCLGDTPR----W---GRWQ--------------D----------A-------EGVGASE----------------T----------ALLT------------R-----AQDLL-------H----RKL----E-------E-YGSGPD----R--YG-L---------IHAD--------LRLANLLV-D--------S--STPQR-T-I-TVIDFDDCGFGWYFYDFGT-AVSF---------I-----------------EHDP-----------R---L--GEW-----------QESW-VAGYRSRR---------ELPAADE-AM-LPSFV-FLRRLL---------------------------------------------------------------------------------
23 HHSearch 72.1518% 28 - C3 - - 5IGI ? A:[2-284] --------------------TVVTTADTSQLYALAARH---G-----L--KLHG-PLTVNELGLDYRI-VI-ATVDDGRRWVLRIP-------R---RA--EV--S-AK---VEPEARVLAMLK---N-RLP-F---------AVPDWRV----------A------------NAELVA--YPMLEDSTA-VI----------Q-----------PGS---------ST------PDWVVPQ-D-------------S----EVF-----------------AESFA-TALAALH------------------A----------V-PISAAVDA-G-------------------------------------M-----LIRTPT-Q----AR-Q-------K----V---ADDV--------------D----------R-------V--R-------------------REFVVND----KRLH------------R-----W-----------Q----RWL----D-------D-DSSWPD----F--SV-V---------VHGD--------LYVGHVLI-D--------NT-E-----RVS-GMIDWSEARVDDPAIDMAA-HLMV---------F-----------------G---------------------EEG-----------LAKL-LLTYEAAG------G-RVWPRLA--HH-IAERL-AFGAVTYALFA----L-DS--------------------------------------------------------------------
44 Fugue 69.2217% -9 - C3 - - 3HAM ? A:[1-299] ----------------------MVNLDAEIYEHLNKQI---K-----I--N----ELRYLSSGDDSDT-FL-CNEQ-YVVKVPKR------------DS--V---R-IS---QKREFELYRFLE---N-C-K-LSY-------QIPAVVY----------Q------------S-------DRF----NIMKY----------I-----------KGERITYEQYHKLS------EK------E-------------K----DAL-----------------AYDEA-TFLKELHSIEIDCSVSLFSDALVNKK----------D-KFLQDKKL-L-------------------------------------I-----S---IL-E----KE-Q-------L----L---TDEM--------------L----------E-------H--I-------------------E----------TIYE------------N-----I-----------L----N-N----A-------V-L--FKY----T--PC-L---------VHND--------FSANNMIFRN--------N--R-----L-F-GVIDFGDFNVGDPDNDFLC-LLDC---------S-----------------TD-D-----------F---G--KEF-----------GRKV-LKYYQHKA------P-EVAER----KA-ELNDVYWSIDQIIYGYE----R-KDR-------------EMLIKGVSELLQTQAEMFIF----------------------------------
56 Fugue 65.8519% 21 - C3 - - 4OCV ? A:[24-378] -----------------------TNEALFDVASHFALE---GT----V--D----SIEPYGDGHINTT-YL-VTTD-GPRYILQRMNTGIFPDT---VN--L---M-RN---VELVTSTLKAQG---K-E-T-L---------DIVRTTS----------G------------DTWAEIDGGAW----RVYKF----------I-----------EHT---------MS------YN------LVP-----------N----PDV-----------------FREAG-RAFGDFQ------------------N----------F-LSGF--DA-N-------------------------------------Q-----L---TETI----AH-F-------H----D---TPHR--------------F----------E-------D--F-------------------K----------KALAADELGRAAGCGPE-----I-----------E----F-Y----L-------S-H--ADQ----Y--AV-V---------MDGLRDGSIPLRVTHNDTKL-NNILMDATTG--K-----A-R-AIIDLDTIMPGSMLFDFGD-SIRFGASTALEDER-----------------DLDK-----------V---HFSTEL-----------FRAY-TEGFVGEL------R-DSIT-----AR-EAELL-PFSGNLLTMECGMRFL-ADYLEGDVYFATKYPEHNLVRSRTQIKLVREMEQRADETRAIVADVMETT--------------------
45 Fugue 65.3816% 24 - C3 - - 2Q83 COTI_BACSU A:[11-346] ------------------LSAEDAKKLTELAENVLQGW---D-----V--Q------AEKIDVIQALV-WK-VHTD-SGAVCLKRI-------H---RP------E-KK---ALFSIFAQDYLA---K-K-GMNVPGILPNKKGSLYSKH----------G------------S-------FLF----VVYDW----------I-----------EGR---------PF-------E------L-------------T----VKQ-----------------DLEFIMKGLADFH------------------T----------A-SVGYQPPN-GVPIFTKLGRWPNHYTKRCKQMETWKLMAEAEKEDPFSQ-----L---YL-Q----EI-D-------G----F---IEDG--------------L----------R-------I--K-------------------D----------RLLQS-----------T-----Y-----------V----P-W----T-------E-Q--LKK----S--PN-L---------CHQD--------YGTGNTLL-GE-------N--E-----Q-I-WVIDLDTVSFDLPIRDLRKMIIPL---------L-----------------DTTG-----------V---W--DDE-----------TFNVMLNAYESRA------PLTEEQK----QVMFI--DMLFPYELYDVIR----E-KYV-------------RKSALPKEELESAFEYERIKANALRQLI--------------------------
27 HHSearch 64.9819% 20 - C3 - - 2Q83 COTI_BACSU A:[22-294] -----------------------------LAENVLQGW---D-----V--QAE--KIDVIQ----ALV-WK-VHTD-SGAVCLKRI-------H---RP------E-KK---ALFSIFAQDYLA---K-K-G-M---------NVPGILPNKKGSLYSKHG------------S-------FLF----VVYDW----------I-----------EGR---------PF------EL------T-------------V----KQD-----------------LEFIM-KGLADFH------------------T----------A-SVGYQPPN-G-------------------------------------VPIFTKL---GR-W----P--N-------H----Y---TKRC--------------K----------Q-------M--ETWKLMAEAEKEDPFSQLYLQEID-------GFIE------------D-----G-----------LRIKDR-LL---QSTYVPWTE-Q--LKK----S--PN-L---------CHQD--------YGTGNTLL-G--------E--NE----Q-I-WVIDLDTVSFDLPIRDLRK-MIIP---------L-----------------LDTT-----------GVW-D--DET-----------FNVM-LNAYESRA---------PLTE----E-----------------------------------------------------------------------------------------------
24 HHSearch 62.3618% -0 - C3 - - 5IGH - ? A:[1-284] -------------------MTVVTTADTSQLYALAARH---G-----L--KLHG-PLTVNELGLDYRI-VI-ATVDDGRRWVLRIP-------R---RA--EV--S-AK---VEPEARVLAMLK---N-RLP-F---------AVPDWRV----------A------------NAELVA--YPMLEDSTAMVI----------Q-----------PGS---------ST------PDWVVPQ-D-------------S----EVF-----------------AESFA-TALAALH------------------A----------V-PISAAVDA-G-------------------------------------M-----LIRTPT-Q----AR-Q-------K----V---ADDV--------------D----------R-------V--R-------------------REFVVND----KRLH------------R-----W-----------Q----RWL----D-------D-DSSWPD----F--SV-V---------VHGD--------LYVGHVLI-D--------NT-E-----RVS-GMIDWSEARVDDPAIDMAA-HLMV---------F-----------------G---------------------EEG-----------LAKL-LLTYEAAG------G-RVWPRLA--HH-IAERL-AFGAVTYALFA----L-DS--------------------------------------------------------------------
28 HHSearch 62.2617% 11 - C3 - - 5UXD ? A:[4-252] ------------------------PEDLDALLDLAARH---G-----L--DLDGGTLRTEEIGLDFRV-AF-ARAHDGGDWVLRLP-------R---RP--DV--L-ER---AAVEGRLLAMLA---PHL-D-V---------AVPDWRI----------S------------T-------SEL----IAYPL----------L-----------PGS---------PG------LT------VAADGEVSWHVDMAS----TVY-----------------ARSLG-SVVAQLH------------------A----------V-DAEAAAAT-G-------------------------------------I-----EVRSPA-Q----VR-G-------A----W---RQDL--------------A----------R-------V--G-------------------AEFEIAP----ALRE------------R-----W-----------E----AWL----A-------D-DGCWPG----H--SV-L---------THGE--------LYPAHTLV-E--------D--E-----R-ITAVLDWTTAAVGDPAKDLMF-HQVS---------A------------------------------------P--SAI-----------FEVA-LQAYAEGG-----------------------------------------------------------------------------------------------------------------
38 HHSearch 61.6411% -9 - C3 - - 3DXQ - ? B:[2-261] --------------------------MTDEARAKLAAI---PM----L--AGYT-GPLERLGGLTNLV-FR-A-----GDLCLRIP----------------------N---RANEAVAAREAA---K-A-G-V---------S-PEVLHVD--------P------------A-------TGV----MVTRY----------I-----------AGAQ--------TM------SP------E-------------KFKTRPGS-----------------PARAG-EAFRKLH------------------G----------S-GAVFPFR----------------------------------------F-----E---LF-A----MI-D-------D----Y---LKVL--------------S----------T-------K--N-------------------VTLPAGYH---DVVR------------E-----A-----------G----G-VR---S-------A-LAAHPL----P--LA-A---------CHCD--------PLCENFLD-T--------G--E-----R-M-WIVDWEYSGMNDPLWDLGD-LSVE---------G-----------------KFN-------------------ANQ-----------DEEL-MRAYFGGE---------ARPAER--GR-VVIYK-AMCDLLWTLWG----L-IQL-------------------------------------------------------------------
59 SP3 61.4617% 4 - C3 - - 1J7L KKA3_ENTFL A:[2-264] ---------------------AKMRIS-PELKKLIEKY-----------------RCVKDTEGMSPAKVYK-LVGE-NENLYLKMT-------DSRYKG--T---T-YD---VEREKDMMLWLE---G-K---L---------PVPKVLHFE--------R------------H-------DGWSN--LLMSE----------A-----------DGV---------LCSEEYEDEQ------S-------------P----EKI-----------------IELYA-ECIRLFH------------------S----------IDISDCPYTN-SLDSRL--------------------------------A-----E---LD-Y----LL-N-------N----D---LADV--------------D----------C-------E--N-------------------WEEDTPFK---DPRE------------L-----Y-----------D----F-L----K-------T-E--KPE----E--ELVF---------SHGD--------LGDSNIFVKD--------G--K-----V-S-GFIDLGRSGRADKWYDIAF-CVRS---------I-----------------REDI-----------G---E--EQY-----------VELF-FDLLG--I------K-PDWEK----IK-YYILL-DELF-----------------------------------------------------------------------------------
49 Fugue 61.1813% 4 - C3 - - 3ATS Y3168_MYCTU A:[1-357] TLPAVISRWLSSVLPGGAAPEVTVESGVDSTGMSSETI---I-----L--T----ARWQQDGRSIQQK-LV-ARVA-PAAEDVPVF-------P---TY--R---L-DH---QFEVIRLVGELT---D-V-P-V---------PRVRWIE----------T------------TGDVLG--TPF----FLMDY----------V-----------EGV---------VP------PD------V-------------M----PYTFGDNWFADAPAERQRQLQDATV-AALATLH------------------SIPNAQN----T-FSFLTDTT-L-------------------------------------H-----R---HF-N----WV-R-------S----W---YDFA--------------V----------E-------G--IGRS----------------P----------LLER------------T-----F-----------E----W-L----QSHWPD--D-A--AAR----E--PV-L---------LWGD--------ARVGNVLY-RD-------F--Q-----P-V-AVLDWEMVALGPRELDVAW-MIFA---------H-----------------RVFQ-----------E---L--AGLATLPGLPEVMREDDV-RATYQALT------G-VELGDLHWFYV-YSGVM-WACVFMRTGAR----R-VHF-------------GEIEKPDDVESLFYHAGLMKHLLGEEH---------------------------
22 HHSearch 60.9015% 22 - C3 - - 1ZYL - SRKA_ECOLI A:[8-281] ----------------------FQTLHPDTIMDALFEH---G-----I--RVDS-GLTPL-NSYENRV-YQ-FQDEDRRRFVVKFY-------R---PERWT---A-DQ---ILEEHQFALQLV---N-D-E-V---------PVAAPVAFNGQTLLNH-Q------------G-------FYF----AVFPS----------V-----------GGR---------QF------EA------D-------------N----IDQ-----------------MEAVG-RYLGRMH------------------Q----------T-GRKQLFI----------------------------------------H-----R---PT-I----GLNE-------Y----LIEPRKLF--------------E----------DATL----I--P-------------------SGLKA------AFLK------------A-----T-----------D----E-LIAAVT-------A-HWREDF----T--VL-R---------LHGD--------CHAGNILW-R--------D--------G-P-MFVDLDDARNGPAVQDLWM-LLNG---------D-----------------KAE----------------Q--RMQ-----------LETI-IEAYEEFS---------EFDTAEI-GL-IEPLR-AMRLVYYLAWL----------------------------------------------------------------------------
1 PsiBlast_PDB 60.6822% 21 - C3 - - 2PPQ - KHSE_AGRFC A:[5-228] -----------------------TDITEDELRNFLTQYDVGS-----L--T----SYKGIAE---NSN-FL-LHTT-KDPLILTLY-------E---K---------KND--LPFFLGLMQHLA---A-K-G-L---------SCPLPLP----------R------------K-------DGE----LLGELSGRPAALISFL-----------EGM---------WL------RK------P-------------E----AKH-----------------CREVG-KALAAMHLASEGFEI----------K----------R-PNALSVDG-W-------------------------------------K-----V---LW-D----KS-E-------E----R---ADEV--------------E----------K-------G--L-------------------R----------EEIRP-----------E-----I-----------D----Y-L----A-------A-H--WPK----DLPAG-V---------IHAD--------LFQDNVFF-L--------G--D-----E-LSGLIDFYFACNDLLAYDVSI-CL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
41 HHSearch 59.5314% 13 - C3 - - 4WH3 NAHK_BIFL2 A:[4-286] --------------------------SNEVLFGIASHF---A-----LEGAVT--GIEPYGDGHINTT-YL-VTTD-GPRYILQQM-------N---TS--IFPDTVNL---MRNVELVTSTLK---A-Q-G-K---------ETLDIVPTTSGATWAEID------------G-------GAW----RVYKF----------I-----------EHT---------VS------YNLV----P-------------N----PDV-----------------FREAG-SAFGDFQ------------------N----------F-LSEFDASQ-L-------------------------------------T-----E---TI-AHFHDTP-H-------R----F---EDFK--------------A----------A-------L--A-------------------ADKLGRAAACQPEID------------F-----YLSHA-------D----Q-YAVVMD-------G-LRDGSI----P--LR-V---------THND--------TKLNNILM-D--------ATTG-----KAR-AIIDLDTIMPGSMLFDFGD-SIRF---------G-----------------ASTALEDEKDLSKVHF---S--TEL-----------FRAY-TEGFVGEL------R-GSITA----------------------------------------------------------------------------------------------------
46 Fugue 59.0615% 1 - C3 - - 1J7L KKA3_ENTFL A:[2-264] ----------------------AKMRISPELKKLIEKY---R-----C--V----KDTEGMSPA--KV-YK-LVGE-NENLYLKMT-------D---SR--Y---K-GTTYDVEREKDMMLWLEGKLP-V-P-K---------VLHFERH----------D------------G-------WSN----LLMSE----------A-----------DGV---------LC------SEEYEDEQS-------------P----EKI-----------------IELYA-ECIRLFH------------------SIDISDCPYTNS-LDSRLAEL-D-------------------------------------Y-----L---LN-N----DL-A-------D----V---DCEN--------------W----------E-------E--D-------------------T----------PFKD------------P-----R-----------E----L-Y----D-------F-L--KTEKPEEE--LV-F---------SHGD--------LGDSNIFV-K--------D--G-----K-VSGFIDLGRSGRADKWYDIAF-CVRS---------I-----------------REDI-----------G---E--EQY-----------VELF-FDLLGIKP------D--------------WEKI-KYYILLDELF-----------------------------------------------------------------------------
31 HHSearch 58.5317% 35 - C3 - - 4R78 ? A:[41-279] -------------------------------------------------------SVEQL-GGMTNQN-YL-AKTT-NKQYIVKFF-------G---KG--TEK-L-IN---RQDEKYNLELLK---D-L-G-L---------DVKNYLFD---------I------------E-------AGI----KVNEY----------I-----------ESAI--------TL------DS------TS------------I----KTK-----------------FDKIA-PILQTIH------------------T----------S-AKELRGE----------------------------------------F-----A---PF-E----EI-K-------K----Y---ESLI--------------E----------E-------Q--I-------------------PYANYE-----SVRN------------A-----V-----------F----S-LE---K-------R-LADLGV----D--RK-S---------CHID--------LVPENFIE-S--------PQ-G-----R-L-YLIDWEYSSMNDPMWDLAA-LFLE---------S-----------------EFT-------------------SQE-----------EETF-LSHYESDQ---------TPVSH---EK-IAIYK-ILQDTIWSLWT----V-YKE-------------------------------------------------------------------
48 Fugue 57.7514% 49 - C3 - - 2OLC MTNK_BACSU A:[5-396] ------------------KTPLYETLNESSAVALAVKL---G-----L--TL---TCQEIGDGNLNYV-FH-IYDR---ALIIKQA-------V---PY--WPLTI-DR---ARIESSALIRQGE--H-V-P-H---------LVPRVFY----------SDT----------E-------MAV----TVMED----------LSHLKIARKGLIEGE---------NY------PH------L-------------S----QHI-----------------GEFLG-KTLFYSS------------------DYAL-------E-PKVKKQLV-K-------------------------------------Q-----F---TN-P----EL-C-------D----I---TERLVFTDPFFDHDTNDFE----------E-------E--L-------------------R----------PFVE------------K-----LWNNDSVKIEAAK----L-K----K-------S-F--LTS----A--ET-L---------IHGD--------LHTGSIFA-S--------E--H-----E-T-KVIDPEFAFYGPIGFDVGQ-FIAN---------LFLNALSRDGADREPLYEHVNQ-----------V---W--ETF-----------EETF-SEAWQKDSLDVYANI-DGYLT----DT-LSHIF-EEAIGFAGCEL----I-RRT-------------IGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEFKTITDVIELFKLLVK
50 Fugue 57.6315% 57 - C3 - - 3I1A ? A:[3-330] ----------------------KQPIQAQQLIELLKVH---YGIDIHT--A----QFIQGGADTNAFA-YQ-ADSE-SKSYFIKLK-------Y---GY--H---D-EI---NLSIIRLLHDSG---I-K-E-I---------IFPIHTL----------EAKLFQQLK----H-------FKI----IAYPF----------I-----------HAPNG-------FT------QN------L-------------T----GKQ-----------------WKQLG-KVLRQIHETSVPI------------S----------I-QQQLRKEI-Y-------------------------------------S-----P---KW-R----EI-V-------R----S---FYNQ--------------IEFDNSDDKLTA-------A--F-------------------K----------SFFN------------QNSAAIH-----------R----L-V----D-------T-S--EKL----S--KK-IQPDLDKYVLCHSD--------IHAGNVLVGN--------E--E-----S-I-YIIDWDEPMLAPKERDLMF-IGGG---------V-----------------GNVW-----------N---K--PHE-----------IQYF-YEGYGEIN------V-DKTIL----SY-YRHER-IVEDIAVYGQD----LLSRN-------------QNNQSRLESFKYFKEMFDPNNVVEIAFATE------------------------
30 HHSearch 57.3717% 41 - C3 - - 4R7B - ? A:[41-279] -------------------------------------------------------SVEQL-GGMTNQN-YL-AKTT-NKQYIVKFF-------G---KG--TEK-L-IN---RQDEKYNLELLK---D-L-G-L---------DVKNYLFD---------I------------E-------AGI----KVNEY----------I-----------ESAI--------TL------DS------TS------------I----KTK-----------------FDKIA-PILQTIH------------------T----------S-AKELRGE----------------------------------------F-----A---PF-E----EI-K-------K----Y---ESLI--------------E----------E-------Q--I-------------------PYANYE-----SVRN------------A-----V-----------F----S-LE---K-------R-LADLGV----D--RK-S---------CHID--------LVPENFIE-S--------PQ-G-----R-L-YLIDWEYSSMNDPMWDLAA-LFLE---------S-----------------EFT-------------------SQE-----------EETF-LSHYESDQ---------TPVSH---EK-IAIYK-ILQDTIWSLWT----V-YKE-------------------------------------------------------------------
26 HHSearch 52.7117% 15 - C3 - - 3CSV ? A:[4-255] -------------------------SREDEIRDFLATH---G-----Y--ADW--NRTP--------R-YQRLRSPTGAKAVLMDW-------S---PE--E---G-GD---TQPFVDLAQYLR---N-L-D-I---------SAPEIYAEE--------H------------A-------RGL----LLIED----------L-----------GDA---------LF------TE------VINNDPAQ------E----MPL-----------------YRAAV-DLLIHLH------------------D----------A-QTPELAR----------------------------------------L-----D---PE-T----LS-E-------MTRLAF---SEYR--------------Y----------A-------I--L-------------------GDAAE------DNRK------------R-----F-----------EHRFAQ-IL---S-------A-Q--LEG----D--MV-F---------VHRD--------FHAQNLLW-L--------P--EREGLAR-V-GVIDFQDAKLGHRAYDLVS-LLQD---------A-----------------RRDV---------------P--AQV-----------EAQM-IDHYIQAT---------GVDE----------------------------------------------------------------------------------------------------