@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B7CE77_9FIRM: (2019-01-26 )
MNLEKWIEEKFNTTKYTLEKTDKGISNHNYILTINDTKYMIRVPKKNHESLGLQHEHEKKILTLVSDLDVPTVLFDEKEGIKVTHYIEDVKTFNECKDKDKFARCANLMKSLHTKKAPLFIFNPFGKIEFYKSQIKECIVSFPNEENFLEALKKEYKPNTLCHNDFVQGNILYSDTKDYLIDYEYAAKNDYRFDIASFFSENNIHYIDQRDQFYQTYFDGEIDPMIDVQVQAFERMEDILWGYWANMLYEQRGEQIYFDIAKDKEKHYRG

Atome Classification :

(22 SA) -----------------------------.........10.-----.-------......20........30...--.---------.----------.---------..40........50-....---....60...--..---.---.--.70--..-------...-..-------.80........90.-.-------------------....---.-----------------------------.--.100.......--110.......-120--.------------.----.-----....-------------------------------..130........----------------.---------------140-----------------.-------------------....---...---.150---------------.-.--.---.-.------.----..160---........170..-.-------.-..-.180......----..190.......200....------------------.------------------.-----------------...210.......220--------.-----.-------------.----------...----...230.......-------240.......250.---.-.-----..-...260.......270-------------------------------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) -----------------------------MNLEKWIEEKFN-----T-------TKYTLEKTDKGISNHNYILTI--N---------D----------T---------KYMIRVPKKNHESL-GLQH---EHEKKILTL--VS---D---L--DVP--TV-------LFD-EK-------EGIKVTHYIEDV-K-T-------------------FNEC---K-----------------------------D--KDKFARCANLM--KSLHTKKAPL-F----I------------F----N-----PFGK-------------------------------IEF--YKSQIKEC----------------I---------------V-------------------S-------------------FPNE---ENF---LEA----------------L-K--K---E-Y------K----PNTL----CHNDFVQGNILYS-D-------T-KD-YLI-DYEYAA----KNDYRFDIASFFS--ENNI------------------H------------------Y-----------------IDQRDQFYQTYFDG----------E-----I-------------D----------PMI----DVQVQAFERMEDI-------LWGYWANMLYE-QR---G-E-----QI-YFDIAKDKEKHYRG---------------------------------------------------
1 PsiBlast_PDB 77.1029% 28 - C1 - - 4R77 - ? B:[27-263] ----------------------------------------------------------------GMTNQNYLAKT--T---------N----------K---------QYIVKFFGKGTEKL--INR---QDEKYNLEL--LK---D---LGLDVK--NY-------LFD-IE-------AGIKVNEYIESA-I-T-------------------LDST---S-----------------------------I--KTKFDKIAPIL--QTIHTSAKEL-R----GE-----------F----A-----PFEE-------------------------------IKK--YESLIEEQ----------------IPY-------------A-------------------N-------------------YESV---RNA---VFS----------------L-E--K---R-L------A----DLGVDRKSCHIDLVPENFIESPQ-------G-RL-YLI-DWEYSS----MNDPMWDLAALFL--ES--------------------E------------------F-----------------TSQEEETFLSHYES----------D-----Q-------------T----------PVS----HEKIAIYKILQDT-------IWSLW-TVYKE-EQ---G-E-------------------------------------------------------------------------
3 PsiBlast_PDB 74.9929% 28 - C1 - - 4R7B - ? A:[47-283] ----------------------------------------------------------------GMTNQNYLAKT--T---------N----------K---------QYIVKFFGKGTEKL--INR---QDEKYNLEL--LK---D---LGLDVK--NY-------LFD-IE-------AGIKVNEYIESA-I-T-------------------LDST---S-----------------------------I--KTKFDKIAPIL--QTIHTSAKEL-R----GE-----------F----A-----PFEE-------------------------------IKK--YESLIEEQ----------------IPY-------------A-------------------N-------------------YESV---RNA---VFS----------------L-E--K---R-L------A----DLGVDRKSCHIDLVPENFIESPQ-------G-RL-YLI-DWEYSS----MNDPMWDLAALFL--ES--------------------E------------------F-----------------TSQEEETFLSHYES----------D-----Q-------------T----------PVS----HEKIAIYKILQDT-------IWSLW-TVYKE-EQ---G-E-------------------------------------------------------------------------
57 HHSearch 74.6629% 23 - C1 - - 4R78 ? A:[38-297] ------------------------------------------------------EVLSVEQL-GGMTNQNYLAKT--T---------N----------K---------QYIVKFFGKGTEKL--INR---QDEKYNLELLKDL---G---L--DVK--NY-------LFD-IE-------AGIKVNEYIESAIT-L-------------------DST----S-----------------------------I--KTKFDKIAPIL--QTIHTSAKELRG----E------------F----A-----PFEE-------------------------------IKK--YESLIEEQ----------------IPYANY----------E-------------------S-------------------VRNA---VFS---LEK----------------R-L--A---DLG------V----DRKS----CHIDLVPENFIES-PQ------G-RL-YLI-DWEYSS----MNDPMWDLAALFL--ESEF------------------T------------------S-----------------QEE-ETFLSHYESDQ---------T-----P-------------------------VS----HEKIAIYKILQDT-------IWSLWTVYKEE-Q------G-----ED-FGDYGVNRYQRAV----------------------------------------------------
2 PsiBlast_PDB 73.8829% 36 - C1 - - 4R78 ? A:[47-283] ----------------------------------------------------------------GMTNQNYLAKT--T---------N----------K---------QYIVKFFGKGTEKL--INR---QDEKYNLEL--LK---D---LGLDVK--NY-------LFD-IE-------AGIKVNEYIESA-I-T-------------------LDST---S-----------------------------I--KTKFDKIAPIL--QTIHTSAKEL-R----GE-----------F----A-----PFEE-------------------------------IKK--YESLIEEQ----------------IPY-------------A-------------------N-------------------YESV---RNA---VFS----------------L-E--K---R-L------A----DLGVDRKSCHIDLVPENFIESPQ-------G-RL-YLI-DWEYSS----MNDPMWDLAALFL--ES--------------------E------------------F-----------------TSQEEETFLSHYES----------D-----Q-------------T----------PVS----HEKIAIYKILQDT-------IWSLW-TVYKE-EQ---G-E-------------------------------------------------------------------------
56 HHSearch 73.7129% 23 - C1 - - 4R7B - ? A:[38-297] ------------------------------------------------------EVLSVEQL-GGMTNQNYLAKT--T---------N----------K---------QYIVKFFGKGTEKL--INR---QDEKYNLELLKDL---G---L--DVK--NY-------LFD-IE-------AGIKVNEYIESAIT-L-------------------DST----S-----------------------------I--KTKFDKIAPIL--QTIHTSAKELRG----E------------F----A-----PFEE-------------------------------IKK--YESLIEEQ----------------IPYANY----------E-------------------S-------------------VRNA---VFS---LEK----------------R-L--A---DLG------V----DRKS----CHIDLVPENFIES-PQ------G-RL-YLI-DWEYSS----MNDPMWDLAALFL--ESEF------------------T------------------S-----------------QEE-ETFLSHYESDQ---------T-----P-------------------------VS----HEKIAIYKILQDT-------IWSLWTVYKEE-Q------G-----ED-FGDYGVNRYQRAV----------------------------------------------------
34 Fugue 72.0522% -1 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] GMKELLSTMDLDTDANTIPELKERAHMLCARFLGGAWKTVP-----L-------EHLRISRIKGGMSNMLFLCRL--S---------E----------VYPPIRNEPNKVLLRVYFNPET---ESHL---VAESVIFTL--LS---E---R--HLG--PK-------LYG-IF-------SGGRLEEYIPSR-PLS-------------------CHEI---S-----------------------------L--AHMSTKIAKRV--AKVHQLEVPI-WKE--P------------D----Y-----LCEA-------------------------------LQR--WLKQLTGTVDAEHRFDLPEECGVSS---------------V-------------------N-------------------CLDL---ARE---LEF----------------L-R--A---H-I------SLSKSPVTF----CHNDLQEGNILLP-K---------RL-VLI-DFEYAS----YNYRAFDFANHFI--EWTI------------------D------------------YDIDEAPFYKIQTENFPENDQMLEFFLNYLREQGNTRENELYK-----K-------------S----------EDL----VQETLPFVPVSHF-------FWGVWGLLQVE-LS---P-V-----GFGFADYGRDRLSLYFKHKQLLKNLA------------------------------------------
58 HHSearch 70.6821% -2 - C1 - - 3C5I ? D:[16-353] ------------------------------YIKKICLEKVP-----EWNHFTE-DNLRVKQIL--LTNQLFEVGL--K---------EETANNYNSIRT---------RVLFRIYGKHVDEL--YNT---ISEFEVYKTMSKY---K---I--APQ--LL-------NTF----------NGGRIEEWLYGD-P-L-------------------RIDDL--K-----------------------------N--PTILIGIANVL--GKFHTLSRKRHL----PEH----------WDRTPC-----IFKM-------------------------------MEK--WKNQLFKY----------------KNIEKYN---------C-------------------DIHKYIKE------------SDKF---IKF---MKV----------------Y-SKSD---NLA------N----TIVF----CHNDLQENNIINT-N-------K-CL-RLI-DFEYSG----FNFLATDIANFFI--ETSIDYSVSSYPFFEIDKKKYIS------------------Y-----------------ENR-KLFITAYLSN----------YLDKVVP-------------T----------PKLIDEILEAVEVQALGAHL-------LWGFWSIIRGY-QTKSYN-E-----FD-FFLYAEQRLKMYD----------------------------------------------------
72 SP3 69.9322% 3 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] --GMKELLSTMDLDTDANTIPELKERAHML-CARFLGGAWK-----TVPL----EHLRISRIKGGMSNMLFLCRL--S---------EVYPPIRNEP-N---------KVLLRVYFNPETES---HL---VAESVIFTL--LS---E---R--HLG--PK-------LYG-IF-------SGGRLEEYIPSR-P-LS------------------CHEI---S-----------------------------L--AHMSTKIAKRV--AKVHQLEVPI-W----KEP----------D----Y-----LCEA-------------------------------LQR--WLKQLTGT----------------V---------------D-------------------AEHRFDLPEECGVSSVNCLDLARE---LEF---LRA----------------HIS--L---S-K------S----PVTF----CHNDLQEGNILLP---------K-RL-VLI-DFEYAS----YNYRAFDFANHFI--EWTI------------------D------------------YDIDEAPFYKIQTENFPENDQMLEFFLNYLRE----------Q-----G-------------NTRENELYKKSEDL----VQETLPFVPVSHF-------FWGVWGLLQVELSP---V-G-----FG-FADYGRDRLSLYFKHKQLLKNLA------------------------------------------
54 HHSearch 68.5919% 17 - C1 - - 3DXQ - ? B:[5-282] ------------------------------EARAKLAAIPM-----LA------GYTGPLERLGGLTNLVFRA-------------------------G---------DLCLRIP----------NR---ANEAVAAREAAKA---G---V--SPE--VL-------HVD-PA-------TGVMVTRYIAGAQT-M-------------------SPEK---FKT---------------------------R--PGSPARAGEAF--RKLHGSGAVFPF----R------------F----E-----LFAM-------------------------------IDD--YLKVLSTK----------------N---------------VTLPA---------------G-------------------YHDV---VRE---AGGVRS-------------A-L--A---AHP------L----PLAA----CHCDPLCENFLDT-G-------E-RM-WIV-DWEYSG----MNDPLWDLGDLSV--EGKF------------------N------------------A-----------------NQD-EELMRAYFGG----------E-----A-------------R----------PAE----RGRVVIYKAMCDL-------LWTLWGLIQLA-ND---NPV-----DD-FRAYADGRFARCK----------------------------------------------------
61 HHSearch 67.8724% 11 - C1 - - 5FTG CHKA_HUMAN A:[12-369] -------------------------------AYLWCKEFLP-----GAWRGLREDEFHISVIRGGLSNMLFQCSL--P---------DTTATLGDEP-R---------KVLLRLYG--------EAM---VLESVMFAILAER---S---L--GPK--LY-------GIF-PQ---------GRLEQFIPSR-R-L-------------------DTEEL--S-----------------------------L--PDISAEIAEKM--ATFHGMKMPFNK----EP-----------K----W-----LFGT-------------------------------MEK--YLKEVLRI----------------KFTEESRIKKLHKLLSY-------------------N-------------------LPLE---LEN---LRS----------------L-L--E---STP------S----PVVF----CHNDCQEGNILLL-EGRENSEKQ-KL-MLI-DFEYSS----YNYRGFDIGNHFC--EWMY------------------DYSYEKYPFFRANIRKYPTK-----------------KQQ-LHFISSYLPAF---------Q-----NDFENLSTEEKSIIK----------EEM----LLEVNRFALASHF-------LWGLWSIVQAK-IS---SIE-----FG-YMDYAQARFDAY-----------------------------------------------------
39 Fugue 67.6616% -3 - C1 - - 3ATS Y3168_MYCTU A:[1-357] --------------------------TLPAVISRWLSSVLPGGAAPE-------VTVESGVDSTGMSSETIILTA--R---------W----------QQDGRSIQQ-KLVARVAPAAEDVP-VFPTYRLDHQFEVIRL--VG---ELTDV--PVPRVRW-------IET-TG-------DVLGTPFFLMDY-V-EGVVPPDVMPYTFGDNWFADAPAE---R-----------------------------Q--RQLQDATVAAL--ATLHSIPNAQ-N----T------------F----S-----FLTDTTLHRHFNW----------------------VRS--WYDFAVEG----------------I---------------G-------------------R-------------------SPLL---ERT---FEW----------------L-Q--S---H-WPDDAAAR----EPVL----LWGDARVGNVLYR-D-------F-QP-VAVLDWEMVALGPRELDVAWMIFAHRV--FQEL------------------A------------------GLATLPGLPE--------VMREDDVRATYQALTGV-------E-----L-------------G----------DLH----WFYVYSGVMWACV-------FMRTGARRVHF-GE---I-EKPDDVES-LFYHAGLMKHLLGEEH-------------------------------------------------
65 HHSearch 67.1720% -10 - C1 - - 3MES ? A:[73-403] --------------------------------------------------------IEVKQIFSGLTNQLFVVSI--V---------NELKH------P---------RILFRIYGKHV-KF--YDS---KVELDVFRYLSNI---N---I--APN--II-------ADF-PE---------GRIEEFIDGE-P-L-------------------TTKQ---LQ----------------------------L--THICVEVAKNM--GSLHIINSKR-ADFPSR------------FDKEPI-----LFKR-------------------------------IYL--WREEAKIQ----------------VSKNNIDKELY-----S-------------------K-------------------ILEE---IDQ---LEELIMGGEKFSMERALELK-L--Y---SPA------F----SLVF----AHNDLQENNLLQT-Q-------N-NI-RMI-DYEYSA----INFAGADIANYFC--EYIY------------------D------------------YCSEKQPYFKFKYEDYPCEELRKLFISVYLSQT---------L-----Q-------------EQVMPS-----QQIVHIMTKAVEVFTLISHI-------TWGLWSIA---------V-E-----FD-FTEYANTRFTHYL----------------------------------------------------
62 HHSearch 67.0824% 15 - C1 - - 5FUT CHKA_HUMAN A:[12-369] -------------------------------AYLWCKEFLP-----GAWRGLREDEFHISVIRGGLSNMLFQCSL--P---------DTTATLGDEP-R---------KVLLRLYG------GAEAM---VLESVMFAILAER---S---L--GPK--LY-------GIF-PQ---------GRLEQFIPSR-R-L-------------------DTEEL--S-----------------------------L--PDISAEIAEKM--ATFHGMKMPFNK----EP-----------K----W-----LFGT-------------------------------MEK--YLKEVLRI----------------KFTEESRIKKLHKLLSY-------------------N-------------------LPLE---LEN---LRS----------------L-L--E---STP------S----PVVF----CHNDCQEGNILLL-EGRENSEKQ-KL-MLI-DFEYSS----YNYRGFDIGNHFC--EWMY------------------DYSYEKYPFFRANIRKYPTK-----------------KQQ-LHFISSYLPAF---------Q-----NDFENLSTEEKSIIK----------EEM----LLEVNRFALASHF-------LWGLWSIVQAK-IS---SIE-----FG-YMDYAQARFDAY-----------------------------------------------------
66 HHSearch 64.5720% -17 - C1 - - 3MES ? B:[73-403] --------------------------------------------------------IEVKQIFSGLTNQLFVVSI--V---------NELKH------P---------RILFRIYGKHV--F--YDS---KVELDVFRYLSNI---N---I--APN--II-------ADF-PE---------GRIEEFIDGE-P-L-------------------TTKQ---LQ----------------------------L--THICVEVAKNM--GSLHIINSKR-ADFPSR------------FDKEPI-----LFKR-------------------------------IYL--WREEAKIQ----------------VSKNNQIDKELY----S-------------------K-------------------ILEE---IDQ---LEELIMGGEKFSMERALELK-L--Y---SPA------F----SLVF----AHNDLQENNLLQT-Q-------N-NI-RMI-DYEYSA----INFAGADIANYFC--EYIY------------------D------------------YCSEKQPYFKFKYEDYPCEELRKLFISVYLSQT---------L-----Q-------------EQVMPS-----QQIVHIMTKAVEVFTLISHI-------TWGLWSIA-----S---V-E-----FD-FTEYANTRFTHYL----------------------------------------------------
51 HHSearch 63.8522% 10 - C1 - - 1NW1 - CKA2_CAEEL A:[56-415] -------------------------------AHMLCARFLG-----GAWKTVPLEHLRISRIKGGMSNMLFLCRL--SEVYPPIRNEP----------N---------KVLLRVYFNPETE---SHL---VAESVIFTLLSER---H---L--GPK--LY-------GIF-S---------GGRLEEYIPSR-P-L-------------------SCHEI--S-----------------------------L--AHMSTKIAKRV--AKVHQLEVPIWKE---P------------D----Y-----LCEA-------------------------------LQR--WLKQLTGT----------------V---------------DAEHRFDLPEECGVSSVNCLD-------------------LARE---LEF---LRA----------------H-I--S---LSK------S----PVTF----CHNDLQEGNILLP-K---------RL-VLI-DFEYAS----YNYRAFDFANHFI--EWTI------------------DYDIDEAPFYKIQTENFP-E-----------------NDQMLEFFLNYLREQ---------G-----N-------------TRENELYKKS-EDL----VQETLPFVPVSHF-------FWGVWGLLQVE-LSP--V-G-----FG-FADYGRDRLSLY-----------------------------------------------------
55 HHSearch 62.9719% 21 - C- - - 3DXQ - ? A:[5-282] ------------------------------EARAKLAAIPM-----LA------GYTGPLERLGGLTNLVFRA-------------------------G---------DLCLRIPGK----Y--INR---ANEAVAAREAAKA---G---V--SPE--VL-------HVD-PA-------TGVMVTRYIAGAQT-M-------------------SPEK---FKT---------------------------R--PGSPARAGEAF--RKLHGSGAVFPF----R------------F----E-----LFAM-------------------------------IDD--YLKVLS------------------N---------------VTLPA---------------G-------------------YHDV---VRE---AGGVRS-------------A-L--A---AHP------L----PLAA----CHCDPLCENFLDT-G-------E-RM-WIV-DWEYSG----MNDPLWDLGDLSV--EGKF------------------N------------------A-----------------NQD-EELMRAYFGG----------E-----A-------------R----------PAE----RGRVVIYKAMCDL-------LWTLWGLIQLA-ND---NPV-----DD-FRAYADGRFARCK----------------------------------------------------
50 HHSearch 61.9822% 15 - C1 - - 1NW1 - CKA2_CAEEL B:[56-415] -------------------------------AHMLCARFLG-----GAWKTVPLEHLRISRIKGGMSNMLFLCRL--SEVYPPIRNEP----------N---------KVLLRVYFNPETE---SHL---VAESVIFTLLSER---H---L--GPK--LY-------GIF-S---------GGRLEEYIPSR-P-L-------------------SCHEI--S-----------------------------L--AHMSTKIAKRV--AKVHQLEVPIWKE---P------------D----Y-----LCEA-------------------------------LQR--WLKQLTGT----------------V---------------DAEHRFDLPEECGVSSVNCLD-------------------LARE---LEF---LRA----------------H-I--S---LSK------S----PVTF----CHNDLQEGNILLP-K---------RL-VLI-DFEYAS----YNYRAFDFANHFI--EWTI------------------DYDIDEAPFYKIQTENFP-E-----------------NDQMLEFFLNYLREQ---------G-----N-------------TRENELYKKS-EDL----VQETLPFVPVSHF-------FWGVWGLLQVE-LSP--V-G-----FG-FADYGRDRLSLY-----------------------------------------------------
52 HHSearch 61.5920% 39 * C1 * - 2QG7 - ? E:[110-449] -------------------------------------------------------SLEFQIING-ITNILIKVKD--MSK-------Q----------A---------KYLIRLYGPKTDEI--INR---EREKKISCILYNK---N---I--AKK--IY-------VFF-TN---------GRIEEFMDGY-A-L-------------------SRED---IK----------------------------N--PKFQKLIAKNL--KLLHDIKLNE-NLYK-ELQVTQKVPGTRPS----F-----LWNT-------------------------------IWK--YFHLLNEE----------------R---------------KKICSFDAKANILKLI----D-------------------FDVLRDSIVE---VES----------------L-C--K---REN------S----PIVL----CHCDLLSSNIINT-VGG-----D-SI-SFI-DFEYSC----PMERAYDIANHFN--EYAGFNCDWDLTP---------S------------------K-----------------EEE-YHFIMHYLGTD---------D-----E-------------ELI--------NQL----IREIQPFYICSHI-------NWGLWSLLQGM-HS---S-D-----FD-FINYGMTRLTAS-----------------------------------------------------
53 HHSearch 59.2320% 47 - C1 - - 2QG7 - ? D:[110-449] -------------------------------------------------------SLEFQIINGG-TNILIKVKD--MSK-------Q----------A---------KYLIRLYGPKTD-----NR---EREKKISCILYNK---N---I--AKK--IY-------VFF-TN---------GRIEEFMDGY-A-L-------------------SRED---IK----------------------------N--PKFQKLIAKNL--KLLHDIKLNE-NLYK-ELQVTQKVPGTRPS----F-----LWNT-------------------------------IWK--YFHLLNEE----------------R---------------KKICSFDAKANILKLI----D-------------------FDVLRDSIVE---VES----------------L-C--K---REN------S----PIVL----CHCDLLSSNIINT-VG------D-SI-SFI-DFEYSC----PMERAYDIANHFN--EYAGFNCDWDLTP---------S------------------K-----------------EEE-YHFIMHYLGTD---------D-----E-------------ELI--------NQL----IREIQPFYICSHI-------NWGLWSLLQGM-HS---S-D-----FD-FINYGMTRLTAS-----------------------------------------------------
68 HHSearch 58.5113% -4 - C1 - - 5IGI ? A:[11-301] ------------------------------QLYALAARHGL-----K-------LHGPLTVNELGLDYRIVIATV--DD--------G----------R---------RWVLRIPRRAEV-S--AKV---EPEARVLAMLKNRL--PF--A--VPD--WR-------VAN-AELVAYPMLEDSTA-VIQPGS-S-T-------------------PDWVVPQD-----------------------------S--EVFAESFATAL--AALHAVPISAAV----D------------A----GMLIRTPTQA-------------------------------RQK--VADDVDRV----------------R---------------REFV----------------V-------------------NDKR---LHR---WQR----------------W-L--DDDSSWP------D----FSVV----VHGDLYVGHVLID-NT------ERVS-GMI-DWSEAR----VDDPAIDMAAHLM--VFG--------------------------------------E-----------------EGL-AKLLLTYEAAG---------GR----V-------------W----------PRL----AHHIAERLAFGAV-------TYALFAL-----DS---G-N-----EE-YLAAAKAQLAAAE----------------------------------------------------
41 Fugue 50.3815% 50 - C1 - - 3I1A ? A:[3-330] -----------------------KQPIQAQQLIELLKVHYG-----I-------DIHTAQFIQGGADTNAFAYQADSE---------S----------K---------SYFIKLKYGYHDE----IN---LSIIRLLHD--SG---I---K--EII--FPIHTLEAKLFQ-QL-------KHFKIIAYPFIH-A-P-------------------NGFT---Q-----------------------------NLTGKQWKQLGKVL--RQIHETSVPI-S----I------------Q----Q-----QLRKEIYSPKWREIVRSFYNQIEFDNSDDKLTAAFKSF--FNQNSAAI----------------H---------------R-------------------L-------------------VDTS---EKL---SKK----------------I-Q--P---D-L------D----KYVL----CHSDIHAGNVLVG-N-------E-ESIYII-DWDEPM----LAPKERDLMFIGGGVGNVW------------------N------------------K-----------------PHEIQYFYEGYGEI----------N-----V-------------D----------KTI----LSYYRHERIVEDI-------AV-YGQDLLSR-NQ---N-N-----QS-RLESFKYFKEMFDPNNVVEIAFATE----------------------------------------
37 Fugue 44.7317% 45 - C1 - - 2OLC MTNK_BACSU A:[5-396] -----------------------KTPLYETLNESSAVALAV-----K-------LGLTLTCQEIGDGNLNYVFHI--Y---------D----------R---------ALIIKQAVPYWPLT-IDRA---RIESSALIR--QGEHVP---H--LVP--RV-------FYSDTE-------MAVTVMEDLSHL-K-I-------------------ARKG---LIEGENYPHLSQHIGEFLGKTLFYSSDYALE--PKVKKQLVKQFTNPELCDITERL-V----F------------T----D-----PFFD-------------------------------HDTNDFEEELRPF----------------V---------------E-------------------K-------------------LWNN---DSVKIEAAK----------------L-K--K---S-F------LTS--AETL----IHGDLHTGSIFAS-E-------H-ET-KVI-DPEFAF----YGPIGFDVGQFIA--NLFL------------------N------------------A-----------------LSRDGADREPLYEH----------V-----N-------------Q----------VWE----TFEETFSEAWQKDSLDVYANIDGYLTDTLSH-IF---E-E-----AI-GFAGCELIRRTIGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEFKTITDVIELFKLLVK