@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : B8CXT6_HALOH: (2019-01-26 )
MSNAEIKDKNYKKLKRNAQNIILKYLGEKREIDGVYNNNWVFLTTDNKKPYMVKFVPQNEARRLEIENTMYKFITSKTDIPVPEVLTYGQNQHGSYLLREVIEGHSLKEYFKKTRNVENIFYEAGQILAKLHSIEFEDKGIIKPDLSVKKYDIFSKTEYLFFLEKLFVNGVISREKYSLLKKVDINYYFGGRKNVLCHCDYTPNNILVKNNQIVGIIDFEWASSAPFMDDLVSFDLFAELDGFNRQINSYYKGYKLIKEIDKFYFENINFYKFYRLITMLSYQVGVTDERYDYQFYNKMRKRFKDIIANCQF

Atome Classification :

(22 SA) ------------------------..--.--......10.........20......------.----------.-----------30.....----..-.40...---.---------...--------.50-----..-....-..---60-----.---...--.....70...-.-....80........-----90...---.....100.....--..110----------...-.----.----..-.--120-..-.......130.....---..140-..--....-----.-150-----------...---..----..160-----------.----....--------..170------.-..-------------...---..-.180..--..-----....---190..-.....200......----.-210--.......-220...-....230-...--..---------------------------------..-----.--240.--....---------.-..250.......260.-----------......270.------.-...-----..280----........290--------........300-.......310.---------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ------------------------MS--N--AEIKDKN-YKKLKRNAQNIILKYLG------E----------K-----------REIDGVY----NN-NWVFLT---T---------DNK--------KPY-----MV-KFVP-QN---E------A---RRL--EIENTMYKFI-T-SKTDIPVPEVLTYG-----QNQHG---SYLLREVIEGHSL--KEYF-----------KKT-R----N----VE-N--I---FY-EAGQILAKLHSIEFE---DKGII-KP--DLSV-----K-KYD-----------IFS---KT----EYLFF-----------L----EKLF--------VNG--------V-IS-------------REK---YS-LL-KKV--DI-----NYYF---GGRKN-VLCHCDYTPNNILV----K-NNQ--IVGIIDF-EWASSA-PFMDDL--VSF--DL---------------------------------FA-----E--L-DG--FNRQ---------I-NSYYKGYKLIKEIDKF-----------YFENINFYKF------Y-RLI-----TMLS-----YQVGVTDERY---------DYQFYNKMRKR-FKDIIANC-QF---------------------------------------------------------
39 Fugue 77.5518% 13 - C1 - - 3JR1 ? A:[14-309] --------------------------------NLYFQGMWKSISQVLAEQFGAYYF------I----------K-----------HKEKLYS----GEMNEIWLI---N---------DEV--------QTV-----FV-KINE-RS---Y------R---SMF--RAEADQLALL-A-KTNSINVPLVYGIG-----NSQGH---SFLLLE-----------AL-----------NKS-K----N----KQ-S--S---FT-IFAEKIAQLHQIQGP---DKYGL-DF--DTWL-----G-PIYQPNDWQTSWAKFFS---EN----RIGWQ-----------L----QICK--------EKG--------L-IF-------------GNI---DL-IV-QIV--AD-----TLSK---HNPKP-SILHGNLWIENCIQ----V-DDK--IFV------CNPAC-YWGDRE--CDI--AF---------------------------------SS-----L--F-EP--FP-------------TNFYQRYNEIYPLEEG-----------YLERKLIYQL------Y-YLL-----NFSY-----RYYNKKQ--------------SYVSLTQKL-INQILHK-------------------------------------------------------------
20 PsiBlast_PDB 69.9124% 21 - C1 - - 3UZR ? A:[26-268] ----------------------------D--AEIYEHL-NKQIKINE----LRYLS------S----------G-----------DDSD------------TFLC---N---------EQ-----------Y-----VV-K-VP-KR---D------S---VRISQKRELELYRFLEN-CKLSYQIPAVVY---------QSD---RFNIMKYIKGERITYEQYH-----------KLSEK----E----KD-A--L---AY-DEATFLKELHSIEID---CSVSL-FS--DALV-----N-KKD-----------KFL---QD----KKLLI-----------SILEKEQLL--------TDE--------M-LE-------------HIE----T-IY-ENI--LS-----NAVL---FKYTP-CLVHNDFSANNMIF----R-NNR--LFGVIDFGDFNVGD-PDNDFL--CLL--DC---------------------------------ST-----D--D-FGKEFGRK---------V-LKYYQ------------------------------------------------------------------------------------------------------------------------------------------------------------
46 Fugue 66.5615% -12 - C1 - - 3CSV ? A:[4-333] ---------------------------------------------SREDEIRDFLA------T----------H-----------GYADWNR----TP-RYQRLR---S---------PTG--------AKA-----VLMDWSP-EE---GGDT---Q---PFV--DLAQYLRN-------LDISAPEIYAEE-----HAR-----GLLLIEDLGDALF--TEVI-----------NND-P----A----QEMP--L---YR-AAVDLLIHLHDAQTP---ELARL-DP--ETLS-----EMTRL-----------AFS---E--------YR-----------Y----AIL----------GD--------A-AE-------------DNR---KR-FE-HRF--AQ-----ILSA---QLEGDMVFVHRDFHAQNLLWLPERE-GLA--RVGVIDF-QDAKLG-HRAYDL--VSLLQDA---------------------------------RR-----D--V-PA--QVEA---------QMIDHYIQATGVDESHFR-----------SAYAVIAVQR------NMRIL-----GIFA-----RLSQRFGKRH---------YIEFVPRVWAH-FERGLAHP-ALASAAEEILNALPAPAPEVLERLRA---------------------------------
47 Fugue 66.4615% -16 - C1 - - 2OLC MTNK_BACSU A:[5-396] ----------------------------------KTPL-YETLNESSAVALAVKLG------L----------T-----------LTCQEIG----DG-NLNYVF---H---------IYD--------RAL-----II-KQAV-PY---WPLT---I---DRA--RIESSALIRQ-G-EHVPHLVPRVFYSD-----TEM-A---VTVMEDLSHLKIA--RKGL-----------IEG-E----NYPHLSQ-H--I---GE-FLGKTLFYSSDYALE---PKVKK-QL--VKQF-----T-NPE-----------LCD---IT----ERLVFTDPFFDHDTNDF----EEEL--------RPF--------V-EK-------------LWN---ND-SV-KIEAAKL-----KKSF---LTSAE-TLIHGDLHTGSIFA----S-EHE---TKVIDP-EFAFYG-PIGFDV--GQF--IA---------------------------------NL-----F--L-NA--LSRD---------G-ADREPLYEHVNQVWET-----------FEE-----TF------S-EAW-----QKDS-----LDVYANIDGY---------LTDTLSHIFEE-AIGFAGCE-LIRRTIGLAHVADLDTIVPFDKRIGRKRLALETGTAFIEKRSEFKTITDVIELFKLLVK
49 Fugue 65.7515% 30 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] -----------------GMKELLSTM--D--LDTDANT-IPELKERAHMLCARFLGGAWKTVP----------L-----------EHLRISRIKGGMS-NMLFLC---RLSEVYPPIRNEP--------NKV-----LL-RVYF-NP---E------T---ESH--LVAESVIFTL-L-SERHLGPKLYGIFS-----GGRLE---EYIPSRPLSCHEI--SL----------------------------A-H--M---ST-KIAKRVAKVHQLEVPIWKEPDYL-CE--ALQR-----W-LKQ-----------LTGTVDAE----HRFDL-----------P----EECG--------VSS--------V-NC-------------LDL---AR-EL-EFL--RA-----HISL---SKSPV-TFCHNDLQEGNILL----P-KR----LVLIDF-EYASYN-YRAFDF--ANH--FIEWTIDYDIDEAPFYKIQTENFPENDQMLEFFLNYL-----R--E-QG--NTRE---------N-ELYKKSEDLVQETLPF-----------VPVSHFFWGV------W-GLL-----QVEL-----SPVGFGFADY---------GRDRLSLYFKH-KQLLKNLA------------------------------------------------------------
19 PsiBlast_PDB 65.1324% 21 - C1 - - 3HAV ? A:[5-250] ----------------------------D--AEIYEHL-NKQIKINE----LRYLS------S----------G-----------DDSDTFL----CN-------------------------------EQY-----VV-K-VP-KR---D------S---VRISQKREFELYRFLEN-CKLSYQIPAVVY---------QSD---RFNIMKYIKGERITYEQYH-----------KLSEK----E----KD-A--L---AY-DEATFLKELHSIEID---CSVSL-FS--DALV-----N-KKD-----------KFL---QD----KKLLI-----------SILEKEQLL--------TDE--------M-LE-------------HIE----T-IY-ENI--LN-----NAVL---FKYTP-CLVHNDFSANNMIF----R-NNR--LFGVIDFGDFNVGD-PDNDFL--CLL--DC---------------------------------ST-----D--D-FGKEFGRK---------V-LKYYQ------------------------------------------------------------------------------------------------------------------------------------------------------------
45 Fugue 64.7618% 29 - C1 - - 3HAM ? A:[1-299] ------------------------MV--NLDAEIYEHL-NKQIKIN----------------E----------L-----------RYLSSGD----DS-DTFLC---------------NE--------QYV-----VK-VPKR-DS---V------R---ISQ--KREFELYRFL-ENCKLSYQIPAVVYQS-----D-------RFNIMKYIKGERI--TYEQYHK--------LSE-K----E----KD-A--L---AY-DEATFLKELHSIEIDCSVSLFSD-AL--VNKK-----D-KFL-----------QDK---KL----LISIL-----------E----KEQL--------LTD--------E-ML-------------EHI---ET-IY-ENI--LN-----NAVL---FKYTP-CLVHNDFSANNMIF----R-NNR--LFGVIDF-GDFNVGDPDNDFL--CLL--DC---------------------------------ST-----DDFG-KE--FGRK---------V-LKYYQ-----HKAPEV-----------AERKAELNDV------Y-WSI-----DQII-----YGYERKDREM---------LIKGVSELLQT-QAEMFIF-------------------------------------------------------------
18 PsiBlast_PDB 64.2524% 19 - C1 - - 3HAM ? A:[5-247] ----------------------------D--AEIYEHL-NKQIKINE----LRYLS------S----------G-----------DDSDTFL----CN-------------------------------EQY-----VV-K-VP-KR---D------S---VRISQKREFELYRFLEN-CKLSYQIPAVVY---------QSD---RFNIMKYIKGERITYEQYH-----------KLSEK----E----KD-A--L---AY-DEATFLKELHSIEID---CSVSL-FS--DALV-----N-KKD-----------KFL---QD----KKLLI-----------SILEKEQLL--------TDE--------M-LE-------------HIE----T-IY-ENI--LN-----NAVL---FKYTP-CLVHNDFSANNMIF----R-NNR--LFGVIDFGDFNVGD-PDNDFL--CLL--DC---------------------------------ST-----D--D-FGKEFGRK---------V-LKYYQ------------------------------------------------------------------------------------------------------------------------------------------------------------
42 Fugue 61.0512% 4 - C1 - - 1ZYL - SRKA_ECOLI A:[4-328] -------------------------S--A--FTFQTLH-PDTIMDALFEHGIRVDS------G----------L-----------TPLNS-Y----EN-RVYQFQ---D---------EDR--------RRF-----VV-KFYR-PE---RWT----A---DQI--LEEHQFALQL-V-ND-EVPVAAPVAFNGQTLLNHQGF---YFAVFPSVGGRQF--E------------------A----D----NI-D--Q---ME-AVGRYLGRMHQTGRK---QLFIH-RP--TIGL-----N-EY--------------L---IE----PRKLF-----------E----DATL--------IPS--------G-LK-------------AAF---LK-AT-DEL--IA-----AVTAHWREDFTV-LRLHGDCHAGNILW----R-DG----PMFVDL-DDARNG-PAVQDLWMLLN--GD---------------------------------KA-----E--Q-RM--QLET---------I-IEAYEEFSEFDTAEIG-----------LIEPLRAMRL------V-YYL-----AWLMRRWADPAFPKNFPWLT--------GEDYWLRQTAT-FIEQAKVL-QEPPLQLTPMY------------------------------------------------
54 SP3 59.1415% 24 - C1 - - 1NW1 - CKA2_CAEEL A:[32-426] -------------------GMKELLSTMD--LDTDANT-IPELKERAHMLCARFLG------G----------AWKTVPLEHLRISRIKGGM----SN-MLFLCR---L---------SEVYPPIRNEPNKV-----LL-RVYFNPE---T------E---SHL--VAESVIFTLL-S-ERHL--GPKLYGIF-----SG-------GRLEEYIPSRPL--S--------------CHE-I----S----LA-H--M---ST-KIAKRVAKVHQLEVP---IWKEP-DYLCEALQ-----R-WLK-----------QLT---GTVDAEHRFDL-----------P----EECG--------VSS--------V-NC-------------LDL---AR-EL-EFL--RA-----HISL---SKSPV-TFCHNDLQEGNILL----P-KR----LVLIDF-EYASYN-YRAFDF--ANH--FI---------------------------------EW-----T--I-DY--DIDE---------A-PFYKIQTENFPENDQM-----------LEFFLNYLRE------Q---------------------GNTRENE---------LYKKSEDLVQE-TLPFVPVS-HFFWGVWGLLQVELSPVGFGFADYGRDRLSLYFKHKQLLKNLA----------------
50 Fugue 58.2914% 18 - C1 - - 2QG7 - ? A:[50-458] YPITESNLRILEGEDRSEKAKELLKK--Y--VSNVFEN-EKTLYIYCKYVMLHYGK------DLVNPNEVDSLE-----------FQIINGT----NI-LIKVKD---M---------SKQ--------AKY-----LI-RLYG-PT---D------E---IIN--REREKKISCI-L-YNKNIAKKIYVFFT-----NGRIE---EFMDGYALSREDI--KN----------------------------P-K--F---QK-LIAKNLKLLHDIKLN---ENLYK-EL--QVTQKVPGTR-PSF-----------LWN---TI----WKYFH-----------L----LNEE--------RKK--------I-CSFDAKANILKLIDFDVL---RD-SI-VEV--ES-----LCKR---ENSPI-VLCHCDLLSSNIIN----T-VGEGDSISFIDF-EYSCPM-ERAYDI--ANH-------------------------------------FN-----E--Y-AG--FNCD---------W-DLTPSKEEEYHFIMHYLGTDDEELINQLIREIQPFYI------C-SHI-----NWGL-----WSLLQGMHSF---------DFINYGMTRLTASCLPIFRS-KV---------------------------------------------------------
38 Fugue 58.1017% 21 - C1 - - 1J7L KKA3_ENTFL A:[2-264] ---------------------------------AKMRI-SPELKKLIEKYRCVKDT------E----------G-----------M----------SP-AKVYKL---V---------GEN--------ENL-----YL-KMTD-SRYKGT------T---YDV--EREKDMMLWL-E-GK--LPVPKVLHFE-----RHDGW---SNLLMSEADGVLC--SEEY-----------EDE-Q----S----PE-K--I---IE-LYAECIRLFHSIDIS---DCPYTNSL--DSRL-----A-ELD-----------YLL---NN----DLADV-----------D----CENW--------EED--------T-PF-------------KDP---RE-LY-DFL--KT-----EK-----PEEEL-VFSHGDLGDSNIFV----K-DGK--VSGFIDL-GRSGRADKWYDIA--FCV--RS---------------------------------IR-----E--D-IG--EEQY---------V-ELFFDLL----------------------------------------------------------GIKPDWE---------KIKYYILLDEL-F-------------------------------------------------------------------
56 SP3 56.2512% 0 - C- - - 1F3M - ? C:[1-294] -------------------------S--D--EEILEKL-RSIVSVGDPK--KKYTR------F----------E-----------KIGQGAS----GT-VYTAMD---V---------ATG--------QEV-----AI-RQMN-LQ---Q------Q---PKK--ELIINEILVM-R-ENKNPNIVNYLDSY-----LVGDE---LWVVMEYLAGGSL--TDVV-----------TET-CMDEGQ----IA-A--V---CR-ECLQALEFLHSNQV-------------------------------------------------------------------------------------------------------------------------------------------------------IHRDIKSDNILL----G-MDG--SVKLTDF-GFC------------AQI--TT---------------------------------MV-----G--T-PYWMAPEV---------V-TR--KAYGPKVDIWSL-----------GIMAIEMIEGEPPYLNE-NPL-----RALY-----LIATNGT--P---------ELQNPEKLSAI-FRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATK-------------------
5 PsiBlast_PDB 54.5425% -21 - C1 - - 5IQB AACA_STAAU A:[46-232] ------------------------------------------------------------------------------------------------NN-EYIFKTKFS------------K--------KGYAKEKAIY-NFLN-TN---L------E---TNV--KIPNIEYSYI-S-DELSI-----LGYK-----EIK-G---TFLTPEIYSTMSE--EEQN-----------LLK-R----D----I--------------ASFLRQMHGLDYT---DISEC-TI--D--------N-KQN-----------VLE---------EYILL-----------R----ETIY---------ND--------L-TD-------------IEKDYIES-FM-ERL--NA-----TTVF---EGKK--CLCHNDFSCNHLLL----DGNNR--LTGIIDF----GDS-GIIDEY--CDF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
40 Fugue 54.4512% -0 * C1 * - 3ATS Y3168_MYCTU A:[1-357] --------------------TLPAVI--S--RWLSSVL-PGGAAPEVTVESGVDST------G----------M-----------SSETIIL----TA-RWQQDG---R---------SIQ--------QKL-----VA-RVAP-AA---EDVPVFPT---YRL--DHQFEVIRLV-G-ELTDVPVPRVRWIE-----TTGDVLGTPFFLMDYVEGVVP--PDVMPYTFGDNWFADAPA-E----R----QR-Q--L---QD-ATVAALATLHSIPNA---QNTFS-FL--TDTT-----L-HRH-----------FNW---VR----SWYDF-----------A----VEGI--------GRS--------P-LL-------------ERT---FE-WL-QS---HW-----PDDA---AAREP-VLLWGDARVGNVLY----R-DFQ--PVAVLDW-EMVALG-PRELDV--AWM--IF---------------------------------AH-----R--V-FQ--ELAGLATLPGLPEV-MREDDVRATYQALTGV-----------ELGDLHWFYV------Y-SGV-----MWAC-----VFMRTGARRVHFGEIEKPDDVESLFYHAGL-MKHLLGEE-H----------------------------------------------------------
2 PsiBlast_PDB 54.3025% -28 - C1 - - 4ORK AACA_STAAU A:[46-232] ------------------------------------------------------------------------------------------------NN-EYIFKTKFST---------NKK--------KGYAKEKAIY-NFLN-TN---L------E---TNV--KIPNIEYSYI-S-DELSI-----LGYK-----EIK-G---TFLTPEIYSTMSE--EEQN-----------LLK-R----D----I--------------ASFLRQMHGLDYT---DISEC-TI--D--------N-KQN-----------VLE---------EYILL-----------R----ETIY---------ND--------L-TD-------------IEKDYIES-FM-ERL--NA-----TTVF---EGKK--CLCHNDFSCNHLLL----DGNNR--LTGIIDF----GDS-GIIDEY--CDF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 53.8525% -21 - C1 - - 5IQH AACA_STAAU A:[46-232] ------------------------------------------------------------------------------------------------NN-EYIFKTKFS------------K--------KGYAKEKAIY-NFLN-TN---L------E---TNV--KIPNIEYSYI-S-DELSI-----LGYK-----EIK-G---TFLTPEIYSTMSE--EEQN-----------LLK-R----D----I--------------ASFLRQMHGLDYT---DISEC-TI--D--------N-KQN-----------VLE---------EYILL-----------R----ETIY---------ND--------L-TD-------------IEKDYIES-FM-ERL--NA-----TTVF---EGKK--CLCHNDFSCNHLLL----DGNNR--LTGIIDF----GDS-GIIDEY--CDF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 PsiBlast_PDB 53.8425% -27 - C1 - - 5IQC AACA_STAAU A:[46-232] ------------------------------------------------------------------------------------------------NN-EYIFKTKFST---------NKK--------KGYAKEKAIY-NFLN-TN---L------E---TNV--KIPNIEYSYI-S-DELSI-----LGYK-----EIK-G---TFLTPEIYSTMSE--EEQN-----------LLK-R----D----I--------------ASFLRQMHGLDYT---DISEC-TI--D--------N-KQN-----------VLE---------EYILL-----------R----ETIY---------ND--------L-TD-------------IEKDYIES-FM-ERL--NA-----TTVF---EGKK--CLCHNDFSCNHLLL----DGNNR--LTGIIDF----GDS-GIIDEY--CDF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 PsiBlast_PDB 53.6125% -20 - C1 - - 5IQF AACA_STAAU A:[46-232] ------------------------------------------------------------------------------------------------NN-EYIFKTKFST---------NKK--------KGYAKEKAIY-NFLN-TN---L------E---TNV--KIPNIEYSYI-S-DELSI-----LGYK-----EIK-G---TFLTPEIYSTMSE--EEQN-----------LLK-R----D----I--------------ASFLRQMHGLDYT---DISEC-TI--D--------N-KQN-----------VLE---------EYILL-----------R----ETIY---------ND--------L-TD-------------IEKDYIES-FM-ERL--NA-----TTVF---EGKK--CLCHNDFSCNHLLL----DGNNR--LTGIIDF----GDS-GIIDEY--CDF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 53.0925% -19 - C1 - - 6CH4 AACA_STAAU A:[46-232] ------------------------------------------------------------------------------------------------NN-EYIFKTKFST---------NKK--------KGYAKEKAIY-NFLN-TN---L------E---TNV--KIPNIEYSYI-S-DELSI-----LGYK-----EIK-G---TFLTPEIYSTMSE--EEQN-----------LLK-R----D----I--------------ASFLRQMHGLDYT---DISEC-TI--D--------N-KQN-----------VLE---------EYILL-----------R----ETIY---------ND--------L-TD-------------IEKDYIES-FM-ERL--NA-----TTVF---EGKK--CLCHNDFNCNHLLL----DGNNR--LTGIIDF----GDS-GIIDEY--CDF-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
64 HHSearch 50.5521% 41 - C1 - - 4R78 ? A:[42-303] --------------------------------------------------------------V----------E-----------QL-GGMT----NQ-NYLAKT---T-----------N--------KQY-----IV-KFFG-KG---T------EKLINRQ--D-EKYNLEL--L-KDLGLDVKNYLFDI--------------------EAGIKV--NEYI-----------ESAIT----L----DS-T--SIKTKFDKIAPILQTIHTSAKE---LRGEF-AP--FE-------E-IKK-----------YES---LI----EE--------------Q----IPY----------AN--------Y-ES-------------VRN---AVFSL------EK-----RLAD---LGVDR-KSCHIDLVPENFIE----S-PQG--RLYLIDW-EYSSMN-DPMWDL--AAL--FL---------------------------------ES-----E--F-TSQEEETF---------L-SHYESDQTP------V-----------SHEKIAIYKI------L-QDTIWSLWTVYK-----EEQGEDFGDY---------GVNRYQRAVKG-LASY----------------------------------------------------------------
68 HHSearch 34.1915% 20 - C1 - - 2Q83 COTI_BACSU A:[24-292] ------------------------------------------------ENVLQGWDVQAEK-I----------D-----------VIQ--------AL-VWKVHT---D-----------S--------GAV-----CL-KRIH-RP---E------K---KAL--F-SIFAQDY--L-AKKGMNVPGILPNK-----KG-SL---YSKH--GSFLFVV--YDWI-----------EGR-P----F----EL-TVKQ---DLEFIMKGLADFHTASVG---YQPPN-GV--PIFT-----K-LGR-----------WPN---HY----TKRCK-----------Q----METWKLMAEAEKEDPFSQLYLQEIDGF-------------IED---GL-RIKDRL--LQSTYVPWTEQ---LKKSP-NLCHQDYGTGNTLL----G-ENE--QIWVIDL-DTVSFD-LPIRDL--RKM--II---------------------------------PLLDTTGV--WDDET-FNVM---------L-NAYESRAPLT-------------------------------------------------------------------------------------------------------------------------------------------------------